Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of S1PR5
Sphingosine-1-phosphate receptor 5 (S1PR5), also known as S1P receptor 5 or EDG8, is encoded by the S1PR5 gene. It belongs to the endothelial differentiation gene (Edg) family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. On account of ligand specificity and homology, the Edg receptor family is enabled to be divided into two subgroups. The first subgroup binds S1P and comprises Edg1/S1P1, Edg3/S1P3, Edg5/S1P2, Edg6/S1P4, and Edg8/S1P5. The second subgroup binds LPA and contains Edg2/LPA1, Edg4/LPA2, and Edg7/LPA3.
| Basic Information of S1PR5 | |
| Protein Name | Sphingosine-1-phosphate receptor 5 |
| Gene Name | S1PR5 |
| Aliases | S1P receptor 5, S1P5, EDG8 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P29274 |
| Transmembrane Times | 7 |
| Length (aa) | 398 |
| Sequence |
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAPMF LLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARRGPAP VSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIY CQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQA DPFLGLAMANSLLNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD |
Function of S1PR5 Membrane Protein
S1PR5 and Edg2/LPA1 mRNA are predominantly expressed in the CNS white matter. Immunohistochemical analysis has demonstrated that S1PR5 is expressed in NG2-positive OPCs but not in mature oligodendrocytes, whereas expression of S1PR5 transcripts has been measured by reverse transcription (RT)-PCR in differentiated rat oligodendrocytes in culture. In the present study, research has proven that S1PR5 is a fourth, high-affinity sphingosine 1-phosphate receptor by using two mammalian cell lines and frog oocytes. Besides, S1PR5 is similar to Edg-1 in that both S1P receptors are predominantly Giα-linked and are unable to couple to the Gqα pathway.
Application of S1PR5 Membrane Protein in Literature
This article indicates that sphingosine-1-phosphate may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect the proliferative activity of these cells.
This article represents the first characterization of S1P receptor activity via G proteins directly and establishes fundamental differences in coupling.
Authors in this group demonstrate that S1PR5 is a high-affinity sphingosine 1-phosphate receptor that couples to G (i/o) alpha proteins and is expressed predominantly by oligodendrocytes and/or fibrous astrocytes in the rat brain.
Authors find S1PR5 is present in brain, spleen, and peripheral blood mononuclear cells (PBMC) and is overexpressed in leukemic LGL.
This article implies that differences between hS1PR5 and rS1PR5 will be an important point to be considered in the development of selective receptor antagonists.
S1PR5 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-S1PR5 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
