Close

S1PR5 Membrane Protein Introduction

Introduction of S1PR5

Sphingosine-1-phosphate receptor 5 (S1PR5), also known as S1P receptor 5 or EDG8, is encoded by the S1PR5 gene. It belongs to the endothelial differentiation gene (Edg) family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. On account of ligand specificity and homology, the Edg receptor family is enabled to be divided into two subgroups. The first subgroup binds S1P and comprises Edg1/S1P1, Edg3/S1P3, Edg5/S1P2, Edg6/S1P4, and Edg8/S1P5. The second subgroup binds LPA and contains Edg2/LPA1, Edg4/LPA2, and Edg7/LPA3.

Basic Information of S1PR5
Protein Name Sphingosine-1-phosphate receptor 5
Gene Name S1PR5
Aliases S1P receptor 5, S1P5, EDG8
Organism Homo sapiens (Human)
UniProt ID P29274
Transmembrane Times 7
Length (aa) 398
Sequence MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAPMF
LLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARRGPAP
VSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIY
CQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQA
DPFLGLAMANSLLNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD

Function of S1PR5 Membrane Protein

S1PR5 and Edg2/LPA1 mRNA are predominantly expressed in the CNS white matter. Immunohistochemical analysis has demonstrated that S1PR5 is expressed in NG2-positive OPCs but not in mature oligodendrocytes, whereas expression of S1PR5 transcripts has been measured by reverse transcription (RT)-PCR in differentiated rat oligodendrocytes in culture. In the present study, research has proven that S1PR5 is a fourth, high-affinity sphingosine 1-phosphate receptor by using two mammalian cell lines and frog oocytes. Besides, S1PR5 is similar to Edg-1 in that both S1P receptors are predominantly Giα-linked and are unable to couple to the Gqα pathway.

S1PR5 Membrane Protein Introduction

Application of S1PR5 Membrane Protein in Literature

  1. Ulfig N., et al. Evidence for the presence of the sphingosine-1-phosphate receptor Edg-8 in human radial glial fibers. Acta Histochem. 2004. PubMed ID: 15530552

    This article indicates that sphingosine-1-phosphate may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect the proliferative activity of these cells.

  2. Windh R.T., et al. Differential coupling of the sphingosine 1-phosphate receptors Edg-1, Edg-3, and H218/Edg-5 to the G(i), G(q), and G(12) families of heterotrimeric G proteins. Biol Chem. 1999, 274(39): 27351-8. PubMed ID: 0488065

    This article represents the first characterization of S1P receptor activity via G proteins directly and establishes fundamental differences in coupling.

  3. Im D.S. et al. Characterization of a novel sphingosine 1-phosphate receptor, Edg-8. Biol Chem. 2000, 275(19): 14821-6. PubMed ID: 10799507

    Authors in this group demonstrate that S1PR5 is a high-affinity sphingosine 1-phosphate receptor that couples to G (i/o) alpha proteins and is expressed predominantly by oligodendrocytes and/or fibrous astrocytes in the rat brain.

  4. Kothapalli R., et al. Characterization of a human sphingosine-1-phosphate receptor gene (S1P5) and its differential expression in LGL leukemia. Biochim Biophys Acta. 2002. 1579(2-3): 117-23. PubMed ID: 12427546.

    Authors find S1PR5 is present in brain, spleen, and peripheral blood mononuclear cells (PBMC) and is overexpressed in leukemic LGL.

  5. Niedernberg A., et al. Comparative analysis of human and rat S1P(5) (edg8): differential expression profiles and sensitivities to antagonists. Biochem Pharmacol. 2002. 64(8): 1243-50. PubMed ID: 12234605

    This article implies that differences between hS1PR5 and rS1PR5 will be an important point to be considered in the development of selective receptor antagonists.

S1PR5 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-S1PR5 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us