Close

SCN1B Membrane Protein Introduction

Introduction of SCN1B

SCN1B gene encodes a beta-1 subunit of voltage-gated sodium channels, known as sodium channel subunit beta-1 (SCN1B). Voltage-gated sodium channels are multimeric protein complexes which consist of an ion-conducting pore forming alpha-subunit regulated by one or more beta-1, beta-2 and beta-3. Beta-1 and beta-3 combine with alpha subunit by non-covalent bond, while beta-2 is covalently linked by disulfide bonds. For voltage-gated Na+ channel functional property, alpha subunit provides channel activity, and beta-1 subunit modulates the kinetics of channel inactivation. The protein has two isoforms: isoform 1 is highly expressed in skeletal muscle, heart and brain. Like isoform 1, isoform 2 presents a very high level in brain and skeletal muscle, and it is also highly expressed in heart, placenta, lung, liver, kidney and pancreas.

Basic Information of SCN1B
Protein Name Sodium channel subunit beta-1
Gene Name SCN1B
Aliases ATFB13, BRGDA5, EIEE52, GEFSP1
Organism Homo sapiens (Human)
UniProt ID Q07699
Transmembrane Times 1
Length (aa) 218
Sequence MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE

Function of SCN1B Membrane Protein

SCN1B is crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. SCN1B can modulate multiple alpha subunit isoforms from the brain, skeletal muscle, and heart. Its association with NFASC may target the sodium channels in the nodes of Ranvier in developing axons and retain these channels at the nodes in mature myelinated axons. Mutations in the SCN1B gene are associated with generalized epilepsy with febrile seizures plus, Brugada syndrome 5, and defects in cardiac conduction.

Schematic showing overlap between Brugada and other inherited cardiac arrhythmia syndromes resulting from genetic defects secondary to loss-of-function of sodium (INa) and/or calcium (ICa) channel current. Fig.1 Schematic showing overlap between Brugada and other inherited cardiac arrhythmia syndromes resulting from genetic defects secondary to loss-of-function of sodium (INa) and/or calcium (ICa) channel current. (Savio-Galimberti, 2018)

Application of SCN1B Membrane Protein in Literature

  1. Lin X., et al. Scn1b deletion leads to increased tetrodotoxin-sensitive sodium current, altered intracellular calcium homeostasis and arrhythmias in murine hearts. Journal of Physiology. 2015, 593(6):1389-407. PubMed ID: 25772295

    This article finds that disrupted intracellular Ca2+ homeostasis in ventricular myocytes life-threatening arrhythmias may partly attribute to mutations of SCN1B.

  2. Ricci M.T., et al. SCN1B gene variants in Brugada Syndrome: a study of 145 SCN5A-negative patients. Scientific Reports. 2014, 4:6470. PubMed ID: 25253298

    This article finds two known and two novel SCN1B variants with low evidence of pathogenicity, providing more evidence regarding the occurrence of SCN1B variants in Brugada syndrome.

  3. Brackenbury W.J., et al. Abnormal neuronal patterning occurs during early postnatal brain development of Scn1b-null mice and precedes hyperexcitability. Proc Natl Acad Sci U S A. 2013, 110(3):1089-94. PubMed ID: 23277545

    This article suggests abnormal neuronal patterning caused by SCN1B deletion may induce hyperexcitability.

  4. Riuró H., et al. A missense mutation in the sodium channel β1b subunit reveals SCN1B as a susceptibility gene underlying long QT syndrome. Heart Rhythm. 2014, 11(7):1202-9. PubMed ID: 24662403

    This article reveals that β1bP213T subunit on Nav1.5 function is consistent with an LQTS phenotype and provides evidence that SCN1Bb may be a new gene probably responsible for LQTS.

  5. Lopez-Santiago L.F., et al. Na+ channel Scn1b gene regulates dorsal root ganglion nociceptor excitability in vivo. Journal of Biological Chemistry. 2011, 286(26):22913-23. PubMed ID: 21555511

    This article suggests that Scn1b regulates the dorsal root ganglion nociceptor excitability in vivo by modulating both I(Na) and I(K).

SCN1B Preparation Options

Membrane protein studies have been applied in many fields. Based on our versatile MemDX™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SCN1B antibody development services.


With years of experience, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are happy to accelerate the development of our clients’ programs with our one-stop, custom-oriented service. For more detailed information, please feel free to contact us.

Reference

  1. Savio-Galimberti E, et al. (2018). Cardiac arrhythmias related to sodium channel dysfunction. Handbook of experimental pharmacology. 246: 331-354.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us