Close

SLC18A2 Membrane Protein Introduction

Introduction of SLC18A2

The Synaptic vesicular amine transporter, also known as the solute carrier family 18 member 2 (SLC18A2), is a protein encoded by the SLC18A2 gene in humans. SLC18A2 is a complete transmembrane protein that transports monoamines, especially neurotransmitters such as dopamine, norepinephrine, serotonin, and histamine, from the cellular cytoplasm to synaptic vesicles. In the striatum pathway and the mid-edge pathway dopamine-releasing neurons, SLC18A2 function is also required for vesicle release from the neurotransmitter GABA. SLC18A2 is thought to possess at least two different binding sites characterized by the binding of tetrabenazine (TBZ) and reserpine to the transporter.

Basic Information of SLC18A2
Protein Name Synaptic vesicular amine transporter
Gene Name SLC18A2
Aliases Monoamine transporter, Solute carrier family 18 member 2, Vesicular amine transporter 2 (VAT2)
Organism Homo sapiens (Human)
UniProt ID Q05940
Transmembrane Times 12
Length (aa) 514
Sequence MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD

Function of SLC18A2 Membrane Protein

SLC18A2 is involved in the transfer of monoamines to synaptic vesicles and is associated with many neuropsychiatric disorders including major depression. SLC18A2 is a necessary condition for releasing neurotransmitters from axonal terminals of monoamine neurons to the synaptic cleft. If SLC18A2 function is inhibited or destroyed, monoamine neurotransmitters, such as dopamine, cannot be released into the synapse by a typical release mechanism. Cocaine users were significantly reduced in SLC18A2 immune activity. Patients with mood disorders caused by cocaine show significant loss of SLC18A2 immunoactivity; this may reflect damage to dopamine axon terminals in the striatum. These neuronal changes may cause confusing emotional and motivational processes among more addictive users.

The structure of Synaptic vesicular amine transporter. Fig.1 The structure of Synaptic vesicular amine transporter.

Application of SLC18A2 Membrane Protein in Literature

  1. Haldrup C., et al. Large-scale Evaluation of SLC18A2 in Prostate Cancer Reveals Diagnostic and Prognostic Biomarker Potential at Three Molecular Levels. Molecular Oncology. 2016,10 (6): 825-837. PubMed ID: 26905753

    The results highlight SLC18A2 as a new promising methylation marker for PC diagnosis. In addition, SLC18A2 expression (RNA and protein) showed promising prognostic potential beyond conventional clinicopathological variables. Therefore, the new slc18a2 based molecular test can be applied to personal computers for the detection and identification of high-risk patients in the future.

  2. Solovieff N., et al. Genetic Association Analysis of 300 Genes Identifies a Risk Haplotype in SLC18A2 for Post-Traumatic Stress Disorder in Two Independent Samples. Neuropsychopharmacology. 2014,39 (8): 1872-1879. PubMed ID: 24525708

    These data is consistent with the genetic structure of PTSD, which is highly polygenic and is affected by many weakly affected SNPs and may overlap with mood disorders.

  3. Lohr K. M., et al. Increased Vesicular Monoamine Transporter 2 (VMAT2; Slc18a2) Protects against Methamphetamine Toxicity. ACS chemical neuroscience. 2015,6 (5): 790-799. PubMed ID: 25746685

    These results indicate that SLC18A2 enhances toxicity to METH without increasing the efficacy of the drug.

  4. Lin Z., et al. High Regulatability Favors Genetic Selection in SLC18A2, a Vesicular Monoamine Transporter Essential for Life. The FASEB Journal. 2010,24(7): 2191-2200. PubMed ID: 20181938

    These findings suggest that the diversity of transcriptional rules is the driving force for haplotype selection in SLC18A2.

  5. Xiong N., et al. hVMAT2: A Target of Individualized Medication for Parkinson’s Disease. Neurotherapeutics. 2016,13 (3): 623-634. PubMed ID: 27137201

    Genetic findings from these drugs suggest that hVMAT2 may be a risk factor and target it as a genetic drug for PD.

SLC18A2 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC18A2 antibody development services.


Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us