Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsUCP5 (SLC25A14) was first described and named as brain mitochondrial carrier protein-1 (BMCP1), which is a member of the mitochondrial solute carrier 25 (SLC25) family. The oxidative phosphorylation of UCPs separated from ATP synthesis, the energy is dissipated as heat, the process of which is also known as mitochondrial proton leakage. UCPs promote the transfer of anions from the inner to outer mitochondrial membranes, as well as the reflow of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential of mammalian cells. The exact method by which tissue specificity occurs in different UCPs and UCPs to transfer H+/OH is unknown. UCPs contain three homologous protein domains of MACPs.
| Basic Information of SLC25A14 | |
| Protein Name | Brain mitochondrial carrier protein 1 |
| Gene Name | SLC25A14 |
| Aliases | Mitochondrial uncoupling protein 5 (UCP 5), Solute carrier family 25 member 14 |
| Organism | Homo sapiens (Human) |
| UniProt ID | O95258 |
| Transmembrane Times | 6 |
| Length (aa) | 325 |
| Sequence | MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI |
SLC25A14 is widely expressed in many tissues. And it has a high expression in the brain and testis. The gene product has an n-terminal hydrophobic domain that is absent from other UCPs. This gene has found two mosaic variants. The expression of SLC25A14 is enhanced in human cerebral ischemic injury in vitro, and its expression has a long-term effect on neuroprotection because it reduces the potential of the mitochondrial membrane and thus reduces the production of reactive oxygen species. The reduction in oxygen can be determined by the increased activity of superoxide degrading enzymes and SLC25A14.
Fig.1 Oxidative phosphorylation in mitochondrial electron transport chain (ETC), and proton leak via uncoupling proteins (UCPs). (Ramsden, 2012)
The results show that the high fructose diet during pregnancy and lactation has a long-term effect on brain mitochondrial function in older rats (fetal planning), which appears to be associated with increased levels of SLC25A14 protein.
These results suggest that MAOB, SLC25A14 and TUBB3 are involved in mitochondrial function in the PFC, thus playing a key role in brain development and fear-related behavior.
This study found that the expression of SLC25A14 had been reduced in at least two of the brain regions of autism patients.
This review covers the current knowledge on the role of SLC25 transporters in health and disease.
This review is mainly about the studies on the role of SLC genes in neurophysiological and pathological processes.
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-KCNAB2 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
