Close

SLC36A2 Membrane Protein Introduction

Introduction of SLC36A2

Proton-coupled amino acid transporter 2 (SLC36A2 or PAT2) belongs to the solute carrier family 36. It is a rheogenic H+ coupled transporter for small, unbranched, dipolar amino and imino acids. The substrates of PAT2 include glycine, alanine, L- and D-proline, trans-4-hydroxyproline, sarcosine, and the amino acid derivative alpha(methyl)aminoisobutyric acid (MeAIB). The transport of SLC36A2 for amino acid derivatives has a narrower substrate selectivity but higher affinity than SLC36A1. In human, SLC36A2 mRNA expression is detected in the kidney and skeletal muscle. Specifically, it is expressed in the S1 segment of the proximal tubule close to the glomerulus. The transport of PAT2 is pH-dependent but the maximal transport is not likely to be altered greatly by changes within the range of pH 7.4-9.3. The gene SLC36A2 is located on human chromosome 5q33.1. The protein comprises 483 amino acids in length and structurally have 11 transmembrane domains.

Basic Information of SLC36A2
Protein Name Proton-coupled amino acid transporter 2
Gene Name SLC36A2, PAT2, TRAMD1
Aliases Solute carrier family 36 member 2Tramdorin-1
Organism Homo sapiens (Human)
UniProt ID Q495M3
Transmembrane Times 11
Length (aa) 483
Sequence MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPFMDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAVNSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTTFVR

Functions of SLC36A2 Membrane Protein

SLC36A2 is expressed at the apical membrane in the renal proximal tubule and is one of the transport systems that are involved in reabsorption of amino acids and derivatives (glycine, proline, and hydroxyproline) from the renal filtrate. Mutations or dysfunction of this protein cause iminoglycinuria (characterized by excess urinary proline, hydroxyproline, and glycine) and hyperglycinuria (characterized by isolated excess urinary glycine). But studies have shown that the inheritance patterns of mutations leading to these disorders are complex. Further, the transport of drugs via this carrier will be affected, which, in turn, will influence the renal reabsorption and the pharmacokinetics of these drugs.

SLC36A2 Membrane Protein Introduction

Application of SLC36A2 Membrane Protein in Literature

  1. Zebisch K. and Brandsch M. Transport of L-proline by the proton-coupled amino acid transporter PAT2 in differentiated 3T3-L1 cells. Amino acids. 2013, 44(2): 373-381. PubMed ID: 22711289

    This study investigates the mechanism and substrate specificity of the PAT2 in 3T3-L1 cells using different substrates such as glycine, L-alanine, and L-tryptophan. The PAT2 is expressed in the 3T3-L1 adipocytes.

  2. Edwards N., et al. Amino acid derivatives are substrates or non-transported inhibitors of the amino acid transporter PAT2 (slc36a2). BBA-Biomembranes. 2011, 1808(1): 260-270. PubMed ID: 20691150

    Using various proline, GABA and tryptophan derivatives, this study investigates if they function either as transported substrates or non-transported inhibitors of PAT2 following heterologous expression of rat PAT2 in Xenopus laevis oocytes.

  3. Ussar S., et al. ASC-1, PAT2, and P2RX5 are cell surface markers for white, beige, and brown adipocytes. Science translational medicine. 2014, 6(247): 247ra103-247ra103. PubMed ID: 25080478

    This study identifies the membrane surface protein PAT2, together with ASC-1 and P2RX5, like new cell surface markers of adipose cell types using a combination of in silico, in vitro, and in vivo methods.

  4. Rubio-Aliaga I., et al. The proton/amino acid cotransporter PAT2 is expressed in neurons with a different subcellular localization than its paralog PAT1. Journal of Biological Chemistry. 2004, 279(4): 2754-2760. PubMed ID: 14600155

    This study investigates the tissue distribution of the PAT2 protein. The results show that this protein is expressed in the spinal cord and brain, contributing to neuronal transport and sequestration of amino acids. The transport direction can be bidirectional, which is dependent on different forces like substrate concentration, pH gradient, and membrane potential.

  5. Vanslambrouck J.M., et al. Renal imino acid and glycine transport system ontogeny and involvement in developmental iminoglycinuria. Biochemical Journal. 2010, 428(3): 397-407. PubMed ID: 20377526

    This study identifies the transporters that are involved in developmental iminoglycinuria and their contribution to renal reabsorption capacity. In addition, the results show that the Slc6a18, Slc6a19, Slc6a20a, and Slc36a2 have delayed expression and maturation in neonatal mice, which might be the molecular mechanism of developmental iminoglycinuria.

SLC36A2 Preparation Options

Creative Biolabs has spent years of efforts in the field of membrane protein preparation and reconstitution, and we have successfully established a powerful MemDX™ Membrane Protein Production Platform that integrates a wide spectrum of strategies and approaches. The proteins can be prepared with or without the aid of detergents. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC36A2 antibody development services.


Contact us or inquire us if you want to know more about our membrane protein-related services.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us