Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of SLC51B
SLC51B encoded by SLC51B gene, also known as OSTβ, is a predicted 128-amino acid, single transmembrane (TM) domain protein. It combines with SLC51A (OSTα) and forms a functional heterodimeric transporter, designated as OSTα-OSTβ. The organic solute transporter OSTα-OSTβ is expressed at the basolateral membrane of epithelium in intestine, kidney, liver, testis, and adrenal gland and involved in the mediation of intestinal absorption of bile acids and the enterohepatic circulation.
| Basic Information of SLC51B | |
| Protein Name | Organic solute transporter subunit beta |
| Gene Name | Q86UW2 |
| Aliases | OSTB, OSTbeta |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q86UW2 |
| Transmembrane Times | 1 |
| Length (aa) | 128 |
| Sequence | MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES |
Function of SLC51B Membrane Protein
SLC51B (OSTβ) is an essential component of the OSTα-OSTβ heterodimer complex that functions as the intestinal basolateral transporter mediating bile acid export from enterocytes into portal blood. And it is essential for intestinal bile acid absorption, and thus for dietary lipid absorption. Besides, OSTα-OSTβ heterodimer complex also participates in the transport of estrone sulfate, taurocholate, digoxin, and prostaglandin E2 across cell membranes. Studies have revealed that the transporter is selectively located to steroidogenic cells of the brain and adrenal gland and transports conjugated steroids, including some neurosteroids, which suggests OSTα-OSTβ may contribute to neurosteroid action. Furthermore, Ostα-Ostβ is also involved in many signaling pathways and biological processes such as triglyceride, glucose and energy homeostasis. In addition, OSTα/β is associated with bile duct disease and biliary tract disease. The elevated expression of OSTα/β is observed in the liver of patients with nonalcoholic steatohepatitis and primary biliary cholangitis.
Fig.1 Selected transporters for endogenous compounds and xenobiotics, expressed on the sinusoidal and canalicular membranes of human hepatocytes. (Niemi, 2011)
Application of SLC51B Membrane Protein in Literature
In this study, results indicate that the dileucine motif in the extracellular N-terminal region of OSTβ subunit is very important for the association with OSTα subunit and for its polarized plasma membrane localization.
The article demonstrates that OSTα-OSTβ is selectively located to steroidogenic cells of the brain and adrenal gland and that it regulates DHEA/DHEAS homeostasis.
This study reports that patients with SLC51B deficiency clinically exhibit congenital chronic diarrhea with the features of cholestatic liver disease.
Hypoxia in hepatocytes is induced by liver injury caused by ischemia-reperfusion, cancer, inflammation or cholestasis. The aim of this study is to investigate the effect of hypoxia on the expression of OSTα-OSTβ and the data suggest OSTα-OSTβ expression is induced by hypoxia.
The data of this research support the hypothesis that OSTα-OSTβ is an essential basolateral transporter of bile acids and conjugated steroids in the intestine, liver, and kidney.
SLC51B Preparation Options
Based on the versatile Magic™ membrane protein production platform, Creative Biolabs can help you to obtain the best soluble and functional target protein to make your project a success. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC51B antibody development services.
As a forward-looking custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
