Introduction of SLC5A4
SLC5A4 (solute carrier family 5 member 4) also known as SAAT1or SGLT3 is a 72.5 kDa transmembrane protein that is composed of 659 amino acids. In humans, it is encoded by the SLC5A4 gene which resides on the chromosome 22q12.3. This low-affinity protein belongs to the sodium-glucose transport (SGLT) family whose members are cotransporters for sugars, vitamins, anions, and short-chain fatty acids. SLC5A4 is found in the small intestine and skeletal muscle. In the small intestine, it is expressed in cholinergic neurons in the submucosal and myenteric plexuses, but not in the enterocyte.
| Basic Information of SLC5A4 | |
| Protein Name | Solute carrier family 5 member 4 |
| Gene Name | SLC5A4 |
| Aliases | SAAT1, SGLT3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9NY91 |
| Transmembrane Times | 14 |
| Length (aa) | 659 |
| Sequence | MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA |
Function of SLC5A4 Membrane Protein
In SGLT family, SGLT1 (SLC5A1) is the most widely studied glucose/galactose transporter highly expressed in the small intestine. SGLT2 (SLC5A2) is a glucose transporter highly expressed in the kidney. SGLT3/SLC5A4 shares 70% amino acid identity to human SGLT1 and 56% to SGLT2. SLC5A4 is not as well characterized as these two better-known family members, while the properties of the human homolog have been found to be unique. Functional studies manifest that SLC5A4 is incapable of sugar transport, concluding it is not a Na(+)/glucose cotransporter but a glucose sensor on the plasma membranes of cholinergic neurons, skeletal muscle, together with other tissues. Electrophysiology studies indicate that glucose induces SLC5A4 to depolarize the plasma membrane in a saturable, Na(+)-dependent, phlorizin-sensitive manner. Additionally, it is also present on the skeletal muscle plasma membrane correlated with nicotinic acetylcholine receptors at the neuromuscular junctions. These data suggest a role for SLC5A4 as a glucose sensor modulating the activity of smooth and skeletal muscles.
Fig.1 Structure of Vibrio parahaemolyticus sodium/galactose symporter (vSGLT) viewed in the membrane plane. (Faham, 2008)
Application of SLC5A4 Membrane Protein in Literature
This article determined that though α-GIs normally delay carbohydrate absorption and potentiate glucagon-like peptide 1 (GLP1) secretion, miglitol can activate duodenal enterochromaffin (EC) cells, probably via SGLT3, and enhance GLP1 secretion by the parasympathetic nervous system.
The whole-genome sequencing of a case of early-stage small-cell lung cancer (SCLC) has been performed to analyze the genomic features. Sanger sequencing of SLC5A4 gene in twenty-three independent SCLC specimens showed another novel nonsynonymous single-nucleotide variations (nsSNVs) in the SLC5A4 gene, indicating nsSNVs in the SLC5A4 gene are recurrent in SCLC.
The aim of this study was to identify the effect of chronic hypoxia on drug transporter mRNA expression and activity in ocular barriers. The 84 transporters in rat choroid-retina revealed that 29 transporter genes are upregulated or downregulated by more than 1.5-fold in hypoxia. Among them, 11 transporters including SLC10a1, SLC5a4, SLC7a11, etc. are upregulated.
This study identified SNPs and CNVs associated with fatness and with estimated major effects in a large population of animals.
The present studies tested the mRNA and protein expression of SGLT3 in human kidney and proximal tubule HK-2 cell line. The results revealed that human SGLT3 (hSGLT3) message and protein were present both in vivo and in vitro.
SLC5A4 Preparation Options
To get stable, intact membrane proteins of interest, Creative Biolabs devotes to establish a versatile MemDX™ membrane protein production platform with several flexible options, such that our customers could select the most optimal approach to achieve their goals. Aided by our robust MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC5A4 antibody development services.
Creative Biolabs is a leading custom service provider in biological markets and has thousands of seasoned stuff to accomplish varieties of requirements on challenging objectives from clients all over the world. Hence, we are very honored to introduce our one-stop, customized membrane protein preparation services for needed scientific projects. If you are interested, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.