Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of SLC6A17
SLC6A17 is encoded by SLC6A17 gene. It belongs to the solute carrier family 6 which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. SLC6A17 transports one, two or three sodium ion(s) together with their organic substrate (symport). It also transports amino acids, of which some are neurotransmitters (glycine and GABA) and the others transport related molecules, such as monoamine neurotransmitters (serotonin, norepinephrine, and dopamine), creatine, or compatible osmolytes (taurine and betaine). Studies conducted on SLC6A17 show that it is related to a wide range of mental illness, such as mental retardation and autosomal recessive 48.
| Basic Information of SLC6A17 | |
| Protein Name | Sodium-dependent neutral amino acid transporter SLC6A17 |
| Gene Name | SLC6A17 |
| Aliases | NTT4 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9H1V8 |
| Transmembrane Times | 12 |
| Length (aa) | 727 |
| Sequence | MPKNSKVTQREHSSEHVTESVADLLALEEPVDYKQSVLNVAGEAGGKQKAVEEELDAEDRPAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAVGQRIRRGSIGVWHYICPRLGGIGFSSCIVCLFVGLYYNVIIGWSIFYFFKSFQYPLPWSECPVVRNGSVAVVEAECEKSSATTYFWYREALDISDSISESGGLNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVDGILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLGFKANIMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAGITTPIIDTFKVPKEMFTVGCCVFAFLVGLLFVQRSGNYFVTMFDDYSATLPLTLIVILENIAVAWIYGTKKFMQELTEMLGFRPYRFYFYMWKFVSPLCMAVLTTASIIQLGVTPPGYSAWIKEEAAERYLYFPNWAMALLITLIVVATLPIPVVFVLRHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL |
Function of SLC6A17 Membrane Protein
SLC6A17 also named as solute carrier family 6 (neurotransmitter transporter), member 17, is a sodium-dependent neurotransmitter transporter. It is expressed exclusively in the nervous system and specifically on synaptic vesicles in glutamatergic and some GABAergic neurons. Recent studies indicate that SLC6A17 defects are associated with severe intellectual disability, such as speech impairment, and behavioral problems. In addition, SLC6A17 has been studied as the Rxt1/NTT4 protein that functions as a vesicular transporter for proline, glycine, leucine, and alanine. It also plays an important role in synaptic transmission.
Fig.1 Phylogenetic tree of the SLC6 transporter family. (Kristensen, 2011)
Application of SLC6A17 Membrane Protein in Literature
This article reports the relationship between SLC6A17 gene polymorphism and severe intellectual disability with progressive tremor, speech impairment, and behavioral problems in certain individuals. These results indicate that homozygous SLC6A17 mutations could be involved in the pathogenesis of these diseases.
This article analyzes the expression level of SLC6A17 in mouse brain using in situ hybridization and immunohistochemistry. The data demonstrate that B0AT3 is highly expressed in both inhibitory and excitatory neurons.
Authors in this group examine the expression of SLC6A17 in the gonadotropin-releasing hormone neurons. The data suggest that differential gene expression is most apparent in GABA-ergic and cholinergic genes.
SLC6A17 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC6A17 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
