Introduction of SLC6A18
SLC6A18 is encoded by SLC6A18 gene. It belongs to the solute carrier family 6 which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. It transports small organic solutes, such as neurotransmitters, amino acids, and osmolytes across the plasma membrane. Studies conducted on SLC6A18 show that the Na+ cotransporter of neutral amino acids defects of SLC6A18 are related to a wide range of illness, such as iminoglycinuria and hartnup disorder.
| Basic Information of SLC6A18 | |
| Protein Name | Sodium-dependent neutral amino acid transporter B(0)AT3 |
| Gene Name | SLC6A18 |
| Aliases | XTRP2 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q96N87 |
| Transmembrane Times | 12 |
| Length (aa) | 628 |
| Sequence | MAHAPEPDPAACDLGDERPKWDNKAQYLLSCTGFAVGLGNIWRFPYLCQTYGGGAFLIPYVIALVFEGIPIFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVAWVLWYLLNSFQHPLPWSSCPPDLNRTGFVEECQGSSAVSYFWYRQTLNITADINDSGSIQWWLLICLAASWAVVYMCVIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTLGLSTMFGTVEAVITPLLDVGVLPRWVPKEALTGLVCLVCFLSATCFTLQSGNYWLEIFDNFAASPNLLMLAFLEVVGVVYVYGMKRFCDDIAWMTGRRPSPYWRLTWRVVSPLLLTIFVAYIILLFWKPLRYKAWNPKYELFPSRQEKLYPGWARAACVLLSLLPVLWVPVAALAQLLTRRRRTWRDRDARPDTDMRPDTDTRPDTDMRPDTDMR |
Function of SLC6A18 Membrane Protein
SLC6A18, also named as solute carrier family 6 (neurotransmitter transporter), member 18, is a sodium and chloride-dependent neutral amino acid transporter. It is expressed exclusively on the luminal membrane of kidney proximal tubules and displays approximately 50% identity with Slc6a19 (B(0)AT1) which is the main neutral amino acid transporter in both kidney and small intestine. Recent studies indicate that the SLC6A18 or neighboring genes are associated with increased susceptibility to myocardial infarction. In addition, research suggests the Slc6a18 transporter is involved in glycine reabsorption and the absence of this transporter is sufficient to cause hypertension.
Fig.1 Role of the SLC6 NTTs in synaptic transmission. (Kristensen, 2011)
Application of SLC6A18 Membrane Protein in Literature
This article analyzes the expression levels of slc6a18 and slc6a19a in the five segments (HL, PMC, GL, DMC, and TS) of the intestine of Mozambique tilapia. These results indicate that slc6a18 is mainly expressed in the middle (GL) and posterior (DMC and TS) intestines, while slc6a19a is specifically expressed in the anterior intestine (HL and PMC).
This article reports the relationship between the human SLC6A18 gene and myocardial infarction (MI) in a Japanese population. The data indicate that the CC+CG genotype of SLC6A18 rs7447815 could be involved in the pathogenesis of myocardial infarction.
Authors in this group conduct a whole exome sequence to identify the genetic alterations which are related to stress fracture. The data demonstrate that three missense mutations (rs7426114, rs4073918, rs3752135 in the NEB, SLC6A18 and SIGLEC12 genes, respectively) and three synonymous mutations (rs2071856, rs2515941, rs716745 in the ELFN2, GRK4, LRRC55 genes) should be potential targets for SF diagnosis.
SLC6A18 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC6A18 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.