Close

SLC6A4 Membrane Protein Introduction

Introduction of SLC6A4

SLC6A4 is encoded by SLC6A4 gene. It belongs to the solute carrier family 6 which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. It is a monoamine transporter protein which can remove the neurotransmitter serotonin from synaptic spaces to presynaptic neurons. Meanwhile, many studies conducted on SLC6A4 show that it is related with various diseases, such as obsessive-compulsive disorder and anxiety.

Basic Information of SLC6A4
Protein Name Sodium-dependent serotonin transporter
Gene Name SLC6A4
Aliases HTT, SERT
Organism Homo sapiens (Human)
UniProt ID P31645
Transmembrane Times 12
Length (aa) 630
Sequence METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV

Function of SLC6A4 Membrane Protein

SLC6A4, also named as 5-hydroxytryptamine (serotonin) transporter (5HTT), is mainly expressed in the lung, small intestine and placenta, and plays an important role in the uptake of the neurotransmitter serotonin (5-HT) from the extracellular milieu. The SLC6A4 gene encoding the serotonin transporter (5-HTT) protein is associated with a greater amygdalar response to emotional stimuli and a greater response to stressors. Recent studies indicate that SLC6A4 variants are strongly associated with infant death syndrome, depression-susceptibility and aggressive behavior. In addition, researches have confirmed SLC6A4 is the molecular target of the selective serotonin re-uptake inhibitors (SSRIs), a common group of anti-depressant.

Representation of the long/short functional variant on the <em>5-HTT</em> gene and the release, reception, and recycling of serotonin in neurons. Fig.1 Representation of the long/short functional variant on the 5-HTT gene and the release, reception, and recycling of serotonin in neurons. (De Neve, 2012)

Application of SLC6A4 Membrane Protein in Literature

  1. Beversdorf D.Q., et al. Influence of serotonin transporter SLC6A4 genotype on the effect of psychosocial stress on cognitive performance: An exploratory pilot study. Cogn Behav Neurol. 2018, 31(2):79-85. PubMed ID: 29927798

    This article reports the association between the SLC6A4 and cognitive performance in 28 healthy young adults. These results indicate that a significant association is found in SLC6A4 and psychosocial stress in healthy young adults.

  2. Kowalska M., et al. The new *G29A and G1222A of HCRTR1, 5-HTTLPR of SLC6A4 polymorphisms and hypocretin-1, serotonin concentrations in migraine patients. Front Mol Neurosci. 2018, 11:191. PubMed ID: 29922128

    This article analyzes the relationship between HCRTR1 and SLC6A4 polymorphisms and migraine in 123 patients and 123 control subjects. These results indicate that HCRTR1 and SLC6A4 genetic characteristics are related to the early age of onset for migraine.

  3. Frodl T., et al. DNA methylation of the serotonin transporter gene (SLC6A4) is associated with brain function involved in processing emotional stimuli. J Psychiatry Neurosci. 2018, 40(5):296-305. PubMed ID: 25825812

    Authors in this group analyze the expression and methylation levels of SLC6A4 in patients with major depressive disorder (MDD). The data show that a low degree methylation of SLC6A4 gene is one of risk factors for MDD.

  4. Ouyang X., et al. Susceptibility and severity of cancer-related fatigue in colorectal cancer patients is associated with SLC6A4 gene single nucleotide polymorphism rs25531 A>G genotype. Eur J Oncol Nurs. 2018, 33:97-101. PubMed ID: 29551185

    This article conducts a direct sequencing to identify the association between SLC6A4 genotypes and the risk of cancer-related fatigue of colon and rectal cancer. The results suggest that SLC6A4 promoter SNP rs25531 is strongly associated with the CRF in patients with colon and rectal cancer.

  5. Amador M.H.B, et al. Molecular and functional characterization of the Gulf toadfish serotonin transporter SLC6A4. J Exp Biol. 2018, 221(Pt 7). PubMed ID: 29487159

    This article analyzes the sequence, tissue distribution, transport kinetics and physiological function of a teleost serotonin transporter (SERT). The data demonstrate that toadfish tissues play an important role in maintaining low 5-HT concentrations in the bloodstream.

SLC6A4 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC6A4 antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. De Neve J E, et al. (2012). Genes, economics, and happiness. J Neurosci Psychol Econ. 5(4).

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us