Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of SLC6A4
SLC6A4 is encoded by SLC6A4 gene. It belongs to the solute carrier family 6 which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. It is a monoamine transporter protein which can remove the neurotransmitter serotonin from synaptic spaces to presynaptic neurons. Meanwhile, many studies conducted on SLC6A4 show that it is related with various diseases, such as obsessive-compulsive disorder and anxiety.
| Basic Information of SLC6A4 | |
| Protein Name | Sodium-dependent serotonin transporter |
| Gene Name | SLC6A4 |
| Aliases | HTT, SERT |
| Organism | Homo sapiens (Human) |
| UniProt ID | P31645 |
| Transmembrane Times | 12 |
| Length (aa) | 630 |
| Sequence | METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV |
Function of SLC6A4 Membrane Protein
SLC6A4, also named as 5-hydroxytryptamine (serotonin) transporter (5HTT), is mainly expressed in the lung, small intestine and placenta, and plays an important role in the uptake of the neurotransmitter serotonin (5-HT) from the extracellular milieu. The SLC6A4 gene encoding the serotonin transporter (5-HTT) protein is associated with a greater amygdalar response to emotional stimuli and a greater response to stressors. Recent studies indicate that SLC6A4 variants are strongly associated with infant death syndrome, depression-susceptibility and aggressive behavior. In addition, researches have confirmed SLC6A4 is the molecular target of the selective serotonin re-uptake inhibitors (SSRIs), a common group of anti-depressant.
Fig.1 Representation of the long/short functional variant on the 5-HTT gene and the release, reception, and recycling of serotonin in neurons. (De Neve, 2012)
Application of SLC6A4 Membrane Protein in Literature
This article reports the association between the SLC6A4 and cognitive performance in 28 healthy young adults. These results indicate that a significant association is found in SLC6A4 and psychosocial stress in healthy young adults.
This article analyzes the relationship between HCRTR1 and SLC6A4 polymorphisms and migraine in 123 patients and 123 control subjects. These results indicate that HCRTR1 and SLC6A4 genetic characteristics are related to the early age of onset for migraine.
Authors in this group analyze the expression and methylation levels of SLC6A4 in patients with major depressive disorder (MDD). The data show that a low degree methylation of SLC6A4 gene is one of risk factors for MDD.
This article conducts a direct sequencing to identify the association between SLC6A4 genotypes and the risk of cancer-related fatigue of colon and rectal cancer. The results suggest that SLC6A4 promoter SNP rs25531 is strongly associated with the CRF in patients with colon and rectal cancer.
This article analyzes the sequence, tissue distribution, transport kinetics and physiological function of a teleost serotonin transporter (SERT). The data demonstrate that toadfish tissues play an important role in maintaining low 5-HT concentrations in the bloodstream.
SLC6A4 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC6A4 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
