Close

SLC7A7 Membrane Protein Introduction

Introduction of SLC7A7

SLC7A7 (solute carrier family 7 member 7), also known as Y+L amino acid transporter 1 or monocyte amino acid permease 2 (MOP-2), is encoded by the gene SLC7A7. SLC7A7 is a member of catalytic chains of the hetero(di)meric amino acid transporters (HATs) subgroup of SLC7 family, and its structure is characterized with 12 transmembrane domains (12TM) with two conserved cysteine residues between TM3 and TM4 and a cytoplasmic N and C termini. The SLC7A7 gene, containing 11exons, is mapped to chromosome 14q11.2. The sodium-independent SLC7A7 transporter is combined with the 4F2hc protein encoded by SLC3A2 to form the cationic amino acid transport system Y+L on the basolateral cell membrane of epithelial cells, which exports cationic amino acids (arginine, lysine and ornithine) out of the cell while importing a large neutral amino acid and a Na+ ion into the cell. It is reported that SLC7A7 expression is regulated by an alternative, TATA-box-containing promoter in specific tissues.

Basic Information of SLC7A7
Protein Name Y+L amino acid transporter 1
Gene Name SLC7A7
Aliases MOP-2, y+LAT1
Organism Homo sapiens (Human)
UniProt ID Q9UM01
Transmembrane Times 12
Length (aa) 511
Sequence MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

Function of SLC7A7 Membrane Protein

The most well-known role of SLC7A7 is acting as a transporter to take part in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Defects in SLC7A7 gene may cause lysinuric protein intolerance (LPI), which is a severe multisystem disorder characterized by protein-rich food intolerance with secondary urea cycle disorders. Moreover, mutations in SLC7A7 cause cation transporter dysfunction, which is associated with various disorders, such as renal dysfunction, high blood ammonia, gastrointestinal symptoms, and abnormal hematopoiesis, growth retardation, osteoporosis, and pulmonary symptoms. It is reported that in human umbilical vein endothelial cells (HUVECs), SLC7A7 contributes to nitric oxide synthesis via transport of L-arginine. Strong evidence shows that prognosis of malignant glioma and multiple myeloma and drug resistance in ovarian cancer is related to SLC7A7 high expression. In T-cell acute lymphoblastic leukemia, downregulation of SLC7A7 increases cell apoptosis rate, but decreases the G1 phase ratio, cell migration, and invasion, suggesting a significant role in the pathogenesis of T-cell acute lymphoblastic leukemia.

The pathogenic model for pulmonary complications in LPI. Fig.1 The pathogenic model for pulmonary complications in LPI. (Rotoli, 2018)

Application of SLC7A7 Membrane Protein in Literature

  1. Ji X., et al. Function of SLC7A7 in T-cell acute lymphoblastic leukemia. Cellular Physiology and Biochemistry. 2018, 48(2): 731-740. PubMed ID: 30025393

    The authors analyzed the role of the SLC7A7 in the cell cycle and cell proliferation, apoptosis, migration, and invasion of Jurkat cells (derived from a 14-year-old T-cell lymphoblastic leukemia patient) and revealed that SLC7A7 contributed to the pathogenesis of T-cell acute lymphoblastic leukemia.

  2. Rotoli B.M., et al. Downregulation of SLC7A7 triggers an inflammatory phenotype in human macrophages and airway epithelial cells. Frontiers in immunology. 2018, 9: 508. PubMed ID: 29616026

    This article utilized short interference RNA (siRNA) in macrophages and airway epithelial cells to demonstrate that SLC7A7 knockdown can induce the expression and release of inflammatory mediators IL1β and TNFα, indicating a potential role of SLC7A7 in inhibition of inflammation.

  3. Tina E., et al. Expression profile of the amino acid transporters SLC7A5, SLC7A7, SLC7A8 and the enzyme TDO2 in basal cell carcinoma. British Journal of Dermatology. 2019, 180(1):130-140. PubMed ID: 29938775

    The authors studied the expression profiles in basal cell carcinoma (BCCs) to find the differences in tumour metabolism, mainly focusing on the SLC 7A5, SLC 7A7, SLC 7A8 and the enzyme TDO2. SLC7A5, SLC7A8 and TDO2 were upregulated in BCCs compared to non-tumour skin.

  4. Zhang G. and Cao L. New mutations in the SLC7A7 gene of two Chinese sisters with lysinuric protein intolerance. Pediatric pulmonology. 2017, 52(11): E94-E96. PubMed ID: 29058386

    The authors discovered two heterozygous mutations in the SLC7A7 gene of two Chinese sisters with lysinuric protein intolerance, deletion of c.1387: del C and IVS4+1C>T.

  5. Zhang H. and Shi W.J. Association of three common single nucleotide polymorphisms of SLC7A7 with the development of glioma in a Chinese population. Genetics and molecular research: GMR. 2017, 16(2). PubMed ID: 28510245

    The authors investigated the association of SLC7A7 polymorphisms (rs12888930, rs12436190, and rs2065134) and the development of glioma in a Chinese population and they found that SLC7A7 rs12436190 was responsible for the high risk of glioma.

SLC7A7 Preparation Options

To obtain the soluble and functional target protein, Creative Biolabs has developed the versatile MemDX™ membrane protein production platform to provide many flexible options, from which you can always find an optimal match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC7A7 antibody development services.


Over years, Creative Biolabs has successfully generated massive functional membrane proteins for our customers. We are happy to provide one-stop, custom-oriented service packages regarding a variety of membrane protein targets. Please contact us for more information if you need.

Reference

  1. Rotoli B M, et al. (2018). Downregulation of SLC7A7 triggers an inflammatory phenotype in human macrophages and airway epithelial cells. Frontiers in immunology. 9, 508.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us