Sortilin is a 100 kDa transmembrane protein encoded by the SORT1 gene, which was first identified in human brain tissue in 1997. Sortilin belongs to the vacuolar protein sorting 10 (Vps10p) family. There are five members of this family, including Sortilin, Sorting Protein Associated Receptor and Type A Repeat (SorLA), Sortilin Associated Receptors SorCS1, SorCS2, and SorCS3. Sortilin consists of an N-terminal signal peptide (1-33 aa), a propeptide (34-78 aa), a Vps10p domain (133-741 aa), ca transmembrane helix (759-780 aa), and an intracellular C-terminal tail (781-831 aa). The extracellular Vps10p domain and intracellular tail are highly conserved in evolution. The Vps10p domain is formed by folding 10 cysteine-rich fragments that appear to be arranged in a tunnel shape with a unique 10-blade beta-propeller that can serve as a ligand-binding channel. The Vps10p domain contains two lysosomal sorting motifs, MS1 (787-FLVHRY-792) and MS2 (823-HDDSDEDLL-831). In addition to being widely expressed in the CNS, sortilin is also expressed in various types of peripheral cells, including hepatocytes, adipocytes, skeletal muscle cells, and macrophages.
| Basic Information of SORT1 | |
| Protein Name | Sortilin |
| Gene Name | SORT1 |
| Aliases | 100 kDa NT receptor, Glycoprotein 95, Neurotensin receptor 3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q99523 |
| Transmembrane Times | 1 |
| Length (aa) | 831 |
| Sequence | MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE |
As an important membrane signaling protein, sortilin binds to a large number of ligands expressed in the central and peripheral cells. Most of the sortilin ligands identified to date are associated with lipid metabolism or neurotrophin signaling. Ligands associated with lipid metabolism include lipoprotein lipase, apolipoprotein A-V (Apo A-V) and ApoB100, which are typically transported to the cell surface by constitutive secretions and then degraded in lysosomes. The neurotrophic signaling pathway is complex, and sortilin participates in signaling transport via three different ways. First, with the help of sortilin, mature neurotrophic factor (mNT) is released into the extracellular space by a pro-neurotrophic factor (proNT) by regulating the secretory pathway. Second, sortilin transports the tyrosine kinase receptor (Trk) to the axonal end by antegrade transport. Third, on the cell surface, sortilin and the neurotrophin receptor (p75NTR) act as partners of proNT transduction for mediating apoptosis under differentiation, senescence, and certain pathological conditions. In addition, sortilin can bind to thyroglobulin and plays a role in the recycling of the latter. Sortilin is also involved in the formation of glucose transporter-4 (Glut4) vesicles, which regulate glucose transport in response to insulin. In conclusion, sortilin is transmitted between the cell surface and the endoplasmic reticulum, Golgi and lysosomes, mediating the different signal transduction, secretion, and degradation of various chaperone proteins, thereby fundamentally affecting their biological functions.
Fig.1 Molecular structure of the Vps10p receptor family of proteins. The extracellular domain of all receptors contains a Vps10p domain (Vps10p-D). (Xu, 2018)
This study indicates that Vps10p member sortilin has been shown to be involved in amyloid plaque formation, abnormal protein sorting and apoptosis, which may provide a new basis for the development of Alzheimer's disease therapy.
This article demonstrates that neuritic plaques seen in the brains of transgenic AD model mice represent an incomplete form of the AD pathology marker in humans, indicating the presence of species differences in neuritic plaque components.
The results of this study demonstrate the novel role of sortilin in energy regulation and lipid homeostasis in female mice, which may be potential therapeutic targets for obesity and cardiovascular disease.
This article finds that sortilin in the Plasmodium falciparum has a wider range of functions compared with most other eukaryotes.
This article comprehensively reviews the contribution of sortilin to cardiovascular and metabolic diseases and finds that sortilin may be a biomarker of cardiovascular risk, which can serve as a potential drug target.
Membrane protein studies have advanced significantly in the past few years. Based on our versatile MemDX™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SORT1 antibody development services.
Creative Biolabs has successfully generated many functional membrane proteins for our global customers during the past years. We are pleased to accelerate the development of our clients’ programs with our one-stop, custom-oriented service. If you want to know more information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.