Introduction of TAAR2
Trace amine-associated receptor 1 (TAAR2), formerly known as G protein-coupled receptor 58 (GPR58), is a protein that in humans is encoded by the TAAR2 gene. And it has 7 transmembrane domains with short N and C terminal extensions. TAAR2 is coexpressed with Gα proteins. In humans, six genes are predicted to exist encoding trace amine-associated receptors, TAAR1, TAAR2, TAAR5, TAAR6, TAAR8 and TAAR9 and are thought to be functional genes. As most of these receptors do not respond to trace amines, each subfamily will presumably have a distinct pharmacological profile, which remains to be identified. So, some article proposes a uniform nomenclature describing this novel GPCR family in all mammalian species as trace-amine-associated receptors (TAARs), which resolves the ambiguities and contradictions of the previous naming.
| Basic Information of TAAR2 | |
| Protein Name | Trace amine-associated receptor 2 |
| Gene Name | TAAR2 |
| Aliases | TAR2, GRP58 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9P1P5 |
| Transmembrane Times | 7 |
| Length (aa) | 351 |
| Sequence |
MAVSSEQHELSHFKRTQTKKEKFNCSEYGNRSCPENERSLGVRVAMYSFMAGSIFITIFGNLAMIISISY FKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKIYYSFDLMLSITSIFHLCSVAID RFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWG TTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAINNLRENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFF TILLDPFLNFSTPVVLFDALTWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKESE |
Function of TAAR2 Membrane Protein
Human TAAR2 (hTAAR2) is expressed in the cerebellum, olfactory sensory neurons in the olfactory epithelium, and leukocytes, but not in the pons, thalamus, hypothalamus, hippocampus, caudate, putamen, frontal cortex, basal forebrain, midbrain or liver. Among other tissues, hTAAR1 and hTAAR2 are both required for white blood cell activation by trace amines in granulocytes. TAAR2 is a probable pseudogene in 10–15% of Asians as a result of a polymorphism that produces a premature stop codon at amino acid 168. TAAR1 is an important paralog for TAAR2. And for the Clinically-relevant mutations and pathophysiology comments, a SNP nonsense mutation in the TAAR2 gene has been associated with schizophrenia.
Fig.1 Structure of TAAR2 membrane protein.
Application of TAAR2 Membrane Protein in Literature
This article found the functional expression of TAAR1 and its closest relative TAAR2 in blood PMN and T and B cells results. And demonstrate that biogenic amines potently regulate blood cell functions via TAAR1 and TAAR2 and open the perspective of their specific pharmacological modulation.
This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.
This article proposes a uniform nomenclature describing this novel GPCR family in all mammalian species as trace-amine-associated receptors (TAARs), which resolves the ambiguities and contradictions of the previous naming.
This article discusses the known functions of human trace amine receptors in brain.
TAAR2 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAAR2 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.