Introduction of TAAR3P
Putative trace amine-associated receptor 3 (TAAR3P) is a protein that in humans is encoded by the TAAR3 gene, belonging to the G-protein coupled receptor 1 family. It is also known as G protein-coupled receptor 57(GPR57), trace amine receptor 3(TAAR3) or trace amine associated receptor 3 (gene/pseudogene). The molecular mass of this protein is 39KD, and the chromosomal location of TAAR3P is in the 6q23.2. TAAR3P also belongs to the Class A Orphans family which is thought to be a pseudogene in man though functional in rodents. In humans, a further five genes are predicted to exist encoding trace amine associated receptors, TAAR2, TAAR5, TAAR6, TAAR8 and TAAR9.
| Basic Information of TAAR3P | |
| Protein Name | Putative trace amine-associated receptor 3 |
| Gene Name | TAAR3P |
| Aliases | TAR-3, TAAR3, GPR57, htaar3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9P1P4 |
| Transmembrane Times | 7 |
| Length (aa) | 343 |
| Sequence |
MDLTYIPEDLSSCPKFVNKILSSHQPLFSCPGDNVFGYDWSHDYPLFGNLVIMVSISHFKQLHSPTNFLI LSMATTDFLLGFVIMPYSIMRSVESCWYFGDGFCKFHTSFDMMLRLTSIFHLCSIAIDRFYAVCYPLHYT TKMTNSTIKQLLAFCWSVPALFSFGLVLSEADVSGMQSYKILVACFNFCALTFNKFWGTILFTTCFFTPG SIMVGIYGKIFIVSKQHARVISHVPENTKGAVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDP YLDYSTPILILDLLVWLRYFNSTCNPLIHGFFNPWFQKAFKYIVSGKIFSSHSETANLFPEAH |
Function of TAAR3P Membrane Protein
TAAR3P is a pseudogene which is not expressed in the pons, thalamus, globus pallidus, caudate, putamen or cerebellum. Its related pathways are peptide ligand-binding receptors and signaling by GPCR. TAAR3P mediates the G-protein coupled receptor activity, trace-amine receptor activity and the sensory perception of chemical stimulus. Besides, it was proven that murine TAAR5 recognize volatile amines and signal through Gs protein/adenylyl cyclases activation. Research has also demonstrated that the agonist profiles of TAAR5 vary notably among mammals and that the agonists identified in mouse may not to be the natural agonists that are responsible for the selective constraints observed among primates.
Fig.1 Anatomical distribution of trace amine-associated receptors (TAARs): expression of members of the TAAR family across the body.
Application of TAAR3P Membrane Protein in Literature
This article shows that the previously cloned and characterized GPCRs from insects and mollusks are more closely related to mammalian serotonin, dopamine, and adrenalin receptors than to mammalian TA receptors.
This paper found TAAR is expressed only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.
Analysis of this subfamily revealed greatest identities between the receptors encoded by GPR57, GPR58. And it found that psiGPR57, GPR58, PNR and the 5-HT(4) pseudogene were mapped in a cluster localized to chromosome 6q22-24. PNR and GPR58 were expressed in COS cells.
This article proposes a uniform nomenclature describing this novel GPCR family in all mammalian species as trace-amine-associated receptors (TAARs), which resolves the ambiguities and contradictions of the previous naming.
This article discusses the known functions of human trace amine receptors in brain.
TAAR3P Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAAR3P antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.