Introduction of TAAR6
Trace amine associated receptor 6 (TAAR6), also known as TAR4, is a protein that in humans is encoded by the TAAR6 gene. This gene belongs to the G-protein coupled receptor 1 family encoding a seven-transmembrane G-protein-coupled receptor which functions as a receptor for endogenous trace amines. TAAR6 also belongs to the trace amine-associated receptor family. It has also reported that TAAR6 in serum may be a clinical biomarker in the diagnosis of vascular cognitive.
| Basic Information of TAAR6 | |
| Protein Name | Trace amine-associated receptor 6 |
| Gene Name | TAAR6 |
| Aliases | TA4, TAR4, TRAR4 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q96RI8 |
| Transmembrane Times | 7 |
| Length (aa) | 345 |
| Sequence |
MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFL VASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVY PTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPT FIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLI DAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI |
Function of TAAR6 Membrane Protein
In tissue specificity, TAAR6 is expressed at low abundance in a variety of brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression are observed in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia. Besides, TAAR6 is related to Cyclosporiasis and Schizophrenia. And the Gene Ontology (GO) annotations related to TAAR6 include G-protein coupled receptor activity and trace-amine receptor activity. In addition, TAAR8 is an essential paralog for TAAR6.
Fig.1 Molecular interactions of PUT and CAD with human TAAR6 and TAAR8. (Izquierdo, 2018)
Application of TAAR6 Membrane Protein in Literature
This article suggests that the TAAR6 rs7772821 polymorphism may be one of the important genetic factors for predicting the response to treatment with inhaled corticosteroids in asthmatics.
This article suggests a possible role of TAAR6 in antidepressant response and suicidal behavior in patients with depressive disorder.
This article analyses the epistasis between a set of variations located in the TAAR6 and HSP-70 genes and find weak associations with the risk of psychosis and response to antipsychotic treatment.
This article reports an association between a set of TAAR6 variations and clinical presentation and outcome in a sample of 240 SZ Korean patients.
The article genotyped 12 single nucleotide polymorphisms (SNPs) in the Irish Case-Control Study of Schizophrenia (ICCSS) sample, and demonstrates that TAAR6 is not associated with schizophrenia in the ICCSS sample.
TAAR6 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAAR6 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.