Close

TAAR6 Membrane Protein Introduction

Introduction of TAAR6

Trace amine associated receptor 6 (TAAR6), also known as TAR4, is a protein that in humans is encoded by the TAAR6 gene. This gene belongs to the G-protein coupled receptor 1 family encoding a seven-transmembrane G-protein-coupled receptor which functions as a receptor for endogenous trace amines. TAAR6 also belongs to the trace amine-associated receptor family. It has also reported that TAAR6 in serum may be a clinical biomarker in the diagnosis of vascular cognitive.

Basic Information of TAAR6
Protein Name Trace amine-associated receptor 6
Gene Name TAAR6
Aliases TA4, TAR4, TRAR4
Organism Homo sapiens (Human)
UniProt ID Q96RI8
Transmembrane Times 7
Length (aa) 345
Sequence MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFL
VASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVY
PTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPT
FIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLI
DAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI

Function of TAAR6 Membrane Protein

In tissue specificity, TAAR6 is expressed at low abundance in a variety of brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression are observed in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia. Besides, TAAR6 is related to Cyclosporiasis and Schizophrenia. And the Gene Ontology (GO) annotations related to TAAR6 include G-protein coupled receptor activity and trace-amine receptor activity. In addition, TAAR8 is an essential paralog for TAAR6.

Molecular interactions of PUT and CAD with human TAAR6 and TAAR8.Fig.1 Molecular interactions of PUT and CAD with human TAAR6 and TAAR8. (Izquierdo, 2018)

Application of TAAR6 Membrane Protein in Literature

  1. Chang H.S., et al. Association between TAAR6 polymorphisms and airway responsiveness to inhaled corticosteroids in asthmatic patients. Pharmacogenetics and genomics. 2015, 25(7):334-42. PubMed ID: 25919112.

    This article suggests that the TAAR6 rs7772821 polymorphism may be one of the important genetic factors for predicting the response to treatment with inhaled corticosteroids in asthmatics.

  2. Pae C.U., et al. TAAR6 variations possibly associated with antidepressant response and suicidal behavior. Psychiatry research. 2010, 180(1):20-4. PubMed ID: 20493543.

    This article suggests a possible role of TAAR6 in antidepressant response and suicidal behavior in patients with depressive disorder.

  3. Pae C.U., et al. Epistasis between a set of variations located in the TAAR6 and HSP-70 genes toward schizophrenia and response to antipsychotic treatment. European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology. 2009, 19(11):806-11. PubMed ID: 19643584.

    This article analyses the epistasis between a set of variations located in the TAAR6 and HSP-70 genes and find weak associations with the risk of psychosis and response to antipsychotic treatment.

  4. Pae C.U., et al. TAAR6 variation effect on clinic presentation and outcome in a sample of schizophrenic in-patients: an open label study. European psychiatry : the journal of the Association of European Psychiatrists. 2008, 23(6):390-5. PubMed ID: 18583103.

    This article reports an association between a set of TAAR6 variations and clinical presentation and outcome in a sample of 240 SZ Korean patients.

  5. Vladimirov V.I., et al. The trace amine associated receptor (TAAR6) gene is not associated with schizophrenia in the Irish Case-Control Study of Schizophrenia (ICCSS) sample. Schizophrenia research. 2009, 107(2-3):249-54. PubMed ID: 18973992.

    The article genotyped 12 single nucleotide polymorphisms (SNPs) in the Irish Case-Control Study of Schizophrenia (ICCSS) sample, and demonstrates that TAAR6 is not associated with schizophrenia in the ICCSS sample.

TAAR6 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAAR6 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Izquierdo C, et al. (2018). Identifying human diamine sensors for death related putrescine and cadaverine molecules. PLoS computational biology. 14(1), e1005945.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us