Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of TACR3
TACR3 (Tachykinin Receptor 3), a G protein-coupled receptor, is encoded by TACR3 gene. TACR3 is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B), and it can interact with G proteins that activate a phosphatidylinositol-calcium second messenger system. Meanwhile, several studies conducted on TACR3 indicate that its mutation can lead to a defect in the control of GnRH, and it plays a role in puberty onset and fertility in humans. TACR3 is regarded to relate with many diseases, such as bronchial hyperresponsiveness, airway inflammation, and cough. It could contribute to improving the treatment of reproductive disorders.
| Basic Information of TACR3 | |
| Protein Name | Tachykinin receptor 3 |
| Gene Name | TACR3 |
| Aliases | NK3R,TAC3R |
| Organism | Homo sapiens (Human) |
| UniProt ID | P29371 |
| Transmembrane Times | 7 |
| Length (aa) | 465 |
| Sequence |
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS |
Function of TACR3 Membrane Protein
The TACR3 belongs to tachykinins receptor family. Various types of the 5'-end of the sequence of TACR3 gene provide the specific receptor affinities. In fact, TACR3 plays a significant role in physiological development and specifically in the human reproductive system, and many diseases also have been proved to be related to the TACR3, including inflammatory bowel diseases, irritable bowel syndrome, squamous cell carcinoma, and gastrointestinal cancers.
Fig.1 Structure of G protein-coupled receptor.
Application of TACR3 Membrane Protein in Literature
This article studies the frequency of GNRHR, FGFR1, TAC3, and TACR3 mutations in nine adolescent and young adult females with clinical cues consistent with partial gonadotropin deficiency, and results show that genetic testing of the GNRHR gene should be necessary to reduce the risk of disease.
This article reviews recent research on GPCR-miRNA interactions related to gastrointestinal pathophysiology, and try to identify the potential biomarkers for gastrointestinal diseases.
Authors analyze the data from three genome-wide association studies and find genetic variation in TACR3 may contribute to the risk of Vasomotor symptoms.
This article examines the expression pattern of TAC3/TACR3 in clinically-resected oral squamous cell carcinoma samples, and the data show TACR3 in the bone matrix can affect gingival oral squamous cell carcinoma cells.
Authors conduct a study in zebrafish to determine whether NKB acts directly on the ovary to regulate reproduction, and they find NK3R mRNA is strongly down-regulated in granulosa cells obtained from polycystic ovary syndrome (PCOS) patients, which can be useful for the PCOS therapy.
TACR3 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TACR3 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
