ACTH (1-39) (Human)
Cat. No.: TDLD-0126-LD918
ACTH (1-39) (Human)
Adrenocorticotropic Hormone (ACTH) (1-39), human, a Therapeutic Peptide and melanocortin receptor agonist, Please note that this product is intended for research purposes only.
| Category | Therapeutic Peptides |
| CAS | 12279-41-3 |
| Formula | C₂₀₇H₃₀₈N₅₆O₅₈S |
| Molecular Weight | 4541.14 |
| Sequence (1-letter) | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH |
| Sequence (3-letter) | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Purity | >95% |
| Form | Solid/Powder |
| Shipping | Ice pack |
| Storage | Store at -20°C. Keep dry and protect from light. |
| Shelf Life | One Year |
Click the button below to contact us or submit your feedback about this product.
