BNP-32 (Porcine)
Cat. No.: TDLD-0126-LD950
BNP-32 (Porcine)
BNP-32 (Porcine), a therapeutic peptide, is a cardiac hormone with natriuretic, diuretic, vasodilatory effects, and influences passive avoidance learning in rats. Please note that this product is intended for research purposes only.
Inquiry
SPECIFIC INQUIRY
Clear All
For Research Use Only. Not for Diagnostic or Treatment Applications.
| Category | Therapeutic Peptides |
| CAS | 117345-87-6 |
| Formula | C₁₄₉H₂₅₀N₅₂O₄₄S₃ |
| Molecular Weight | 3570.1 |
| Sequence (1-letter) | SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge: Cys10-Cys26) |
| Sequence (3-letter) | Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge: Cys10-Cys26) |
| Purity | >95% |
| Form | Solid/Powder |
| Shipping | Ice pack |
| Storage | Store at -20°C. |
| Shelf Life | One Year |
Click the button below to contact us or submit your feedback about this product.
Customer Reviews and Q&As
Related Products
G4RGDSP (TDLD-0126-LD1076)
5-FAM-Labeled TAT (47-57) (TDLD-0126-LD890)
FN-A208 Fusion Peptide (TDLD-0126-LD1071)
CPLGVRGRGDS (TDLD-0126-LD1003)
Urocortin III (Mouse) (TDLD-0126-LD1236)
VSV-G Tag Peptide (TDLD-0126-LD1242)
Urotensin II (Human) (TDLD-0126-LD1237)
CNP-53 (Human) (TDLD-0126-LD1002)
Online Inquiry
