Close

TAS1R1 Membrane Protein Introduction

Introduction of TAS1R1

TAS1R1 (Taste receptor type 1 member 1), a G protein-coupled receptor, is encoded by TAS1R1 gene. It mediates the perception of umami and sweet tastes and regulates metabolism. The TAS1R genes can encode heterodimeric receptors that mediate umami (hTAS1R1 + hTAS1R3) and sweet (hTAS1R2 + hTAS1R3) sensations. Studies conducted on TAS1R1 show it is the repertoire of genotypic and phenotypic marker of heightened taste sensation.

Basic Information of TAS1R1
Protein Name Taste receptor type 1 member 1
Gene Name TAS1R1
Aliases GPR70, T1R1, TR1, GM148
Organism Homo sapiens (Human)
UniProt ID Q7RTX1
Transmembrane Times 7
Length (aa) 841
Sequence MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVT
LCDRSCSFNEHGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLS
LPGQHHIELQGDLLHYSPTVLAVIGPDSTNRAATTAALLSPFLVPMISYAASSETLSVKR
QYPSFLRTIPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIA
FKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLTNLTGKVWVAS
EAWALSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSS
NQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAHGLHQLLGCASGACSRGRVYPWQ
LLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFTVLGSSTWSPVQLNINE
TKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLYRCQPCG
KEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSA
GGRLCFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIF
KFSTKVPTFYHAWVQNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLEC
TETNSLGFILAFLYNGLLSISAFACSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTA
SVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYVILCRPDLNSTEHFQASIQDYTRRCGS
T

Function of TAS1R1 Membrane Protein

TAS1R1 is a component of the heterodimeric taste receptor T1R1+3, which can bind to the G protein, several studies confirm that TAS1R1 and TAS1R2 have also been shown to activate Gαo and Gαi, which can affect human sweet and amino acid taste receptors. Meanwhile, it can also inhibit adenylyl cyclases to decrease cyclic guanosine monophosphate (cGMP) levels in taste receptors. Studies show that it is related to the regulation of cyclic guanosine monophosphate (cGMP) in taste receptors. In addition, research conducted on TAS1R1 indicate that it correlates with umami and sweet taste. It also plays an important role in regulating the phosphatidylinositol (PIP2) pathway.

A working model for the sweet and umami taste receptor structure-function relationships. Fig.1 A working model for the sweet and umami taste receptor structure-function relationships. (Hong, 2004)

Application of TAS1R1 Membrane Protein in Literature

  1. Valente C., et al. Genes from the TAS1R and TAS2R families of taste receptors: looking for signatures of their adaptive role in human evolution. Genome Biol Evol. 2018, 10(4): 1139-1152. PubMed ID: 29635333

    Authors analyze the available sequence variation data from the 1000 Genomes Project Phase 3 for TAS1R (TAS1R1-3) and TAS2R families studies, the data show that TAS1R1 could probably correlated with improved umami and sweet perception of TAS1R genes.

  2. Choi J.H., et al. Variations in TAS1R taste receptor gene family modify food intake and gastric cancer risk in a Korean population. Mol Nutr Food Res. 2016, 60(11): 2433-2445. PubMed ID: 27321875

    This article analyses a total of 1131 Koreans of TAS1R genes to determine whether the dietary intake is associated with Genetic variants. TAS1R1 rs34160967 may lead to the risk for GC independent of diet in Korean males.

  3. Kim J.M., et al. A regulatory gene network related to the porcine umami taste receptor (TAS1R1/TAS1R3). Anim Genet. 2016, 47(1): 114-9. PubMed ID: 26554867

    Authors perform a meta-analysis of 20 gene expression studies and try to identify several taste-related regulatory genes. The result can extend previous genetic background of porcine umami taste.

  4. Rawal S., et al. Do polymorphisms in the TAS1R1 gene contribute to broader differences in human taste intensity? Chem Senses. 2013, 38(8): 719-28. PubMed ID: 24000232

    This article aims at find whether TAS1R1 variation is associated with differences in overall taste intensity, and results indicate that SNPs (intronic rs17492553, C/T and exonic rs34160967, G/A) are associated with modest shifts in perceived intensities across all taste qualities.

  5. Proszkowiec-Weglarz M., et al. Insulin immuno-neutralization decreases food intake in chickens without altering hypothalamic transcripts involved in food intake and metabolism. Poult Sci. 2017, 96(12): 4409-4418. PubMed ID: 29053815

    This author conducts a study in chicken to investigate the effects of 5 hours fasting and 5 hours insulin immuno-neutralization on hypothalamic mRNA levels of 23 genes, including TAS1R1, and these results show it does not rely on hypothalamic abundance of the 23 transcripts analyzed.

TAS1R1 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAS1R1 antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Hong Xu, et al. (2004). Different functional roles of T1R subunits in the heteromeric taste receptors. PNAS. 101(39), 14258-14263.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us