Close

TAS1R2 Membrane Protein Introduction

Introduction of TAS1R2

TAS1R2 (Taste receptor type 1 member 2), a G protein-coupled receptor, is encoded by TAS1R2 gene. It is a component of the heterodimeric amino acid taste receptor T1R2+3, which mediates the perception of umami and sweet tastes and regulates metabolism. The TAS1R2 protein is functional with the formation of the 2+3 heterodimer and can be activated spontaneously without the extracellular domains and binding ligands.

Basic Information of TAS1R2
Protein Name Taste receptor type 1 member 2
Gene Name TAS1R2
Aliases GPR71, T1R2, TR2
Organism Homo sapiens (Human)
UniProt ID Q8TE23
Transmembrane Times 7
Length (aa) 839
Sequence MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCK
EYEVKVIGYNLMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDN
LLPIQEDYSNYISRVVAVIGPDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPAL
LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL
PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWIA
SESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPLSRTSQSYTCN
QECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQL
LEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQD
ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPN
NEWSYQSETSCFKRQLVFLEWHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAG
GPMCFLMLTLLLVAYMVVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFK
MASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSC
NPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYFTSSVSLCTFM
SAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD

Function of TAS1R2 Membrane Protein

The TAS1R2 receptor can respond to natural sugars sucrose and fructose, and to several artificial sugars. Research conducted on rat shows that the receptors can not respond to many other natural and artificial sugars, which suggest there must be more than one type of sweet taste receptor. The TAS1R2 can also bind to the G protein, several studies confirm that TAS1R1 and TAS1R2 have also been shown to activate Gαo and Gαi, which can affect the human sweet taste receptors. Meanwhile, it can inhibit adenylyl cyclases to decrease cyclic guanosine monophosphate (cGMP) levels in taste receptors. The major SNP polymorphism in the sweet taste receptor (TAS1R2) has previously been associated with lower sugar sensitivity and higher sugar intake among overweight individuals.

Sweet taste receptor. Fig.1 Sweet taste receptor.

Application of TAS1R2 Membrane Protein in Literature

  1. Cai C., et al. Genes characterization of the sweet taste receptor Tas1r2 from an old world monkey species rhesus monkey and species-dependent activation of the monomeric receptor by an intense sweetener perillartine. PLoS One. 2016, 11(8). PubMed ID: 27479072

    Authors analyze the taste receptor Tas1r2 from a species of Old World monkeys, the rhesus monkey, and results show that rhesus monkey Tas1r2 could respond to artificial sweeteners and sweet-tasting proteins.

  2. Han P., et al. Salivary leptin and TAS1R2/TAS1R3 polymorphisms are related to sweet taste sensitivity and carbohydrate intake from a buffet meal in healthy young adults. Br J Nutr. 2017, 118(10): 763-770. PubMed ID: 29110749

    This article analyses the SNP of the TAS1R2/TAS1R3 on sweet taste sensitivity, sensory-specific satiety (SSS) and macronutrient intake in healthy human adults, and reveals the association among specific SNP of the TAS1R2/TAS1R3 with various taste sensitivity, macronutrient appetite, and food consumption.

  3. Pioltine M.B., et al. Genetic variations in sweet taste receptor gene are related to chocolate powder and dietary fiber intake in obese children and adolescents. J Pers Med. 2018, 8(1). PubMed ID: 29382185

    Authors conduct a study to evaluate the influence of polymorphisms of the sweet taste receptor gene TAS1R2 on diet and metabolic profile in obese children and adolescents. The data show that SNP allele is related to the status of dietary fiber intake.

  4. Habberstad C., et al. Variation in the sweet taste receptor gene and dietary intake in a swedish middle-aged population. Front Endocrinol (Lausanne). 2017, 8: 348. PubMed ID: 29326656

    This article studies the association between TAS1R2 polymorphisms with lean and overweight Swedish Middle-Aged individuals. Results confirm people who carry specific alleles have the higher carbohydrate intake, but no allele can be a marker of sugar intake in the MDC population.

  5. Melo S.V., et al. Evaluation of the association between the TAS1R2 and TAS1R3 variants and food intake and nutritional status in children. Genet Mol Biol. 2017, 40(2): 415-420. PubMed ID: 28497839

    This study aims to investigate the association of TAS1R2 (Ile191Val - rs35874116) and TAS1R3 (-1266 C/T - rs35744813) variants with food intake and nutritional status in children followed from birth until 7.7 years old. They find a genetic variant of the T1R2 taste receptor is associated with the intake of different amounts of high sugar-content foods in childhood.

TAS1R2 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAS1R2 antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us