Introduction of TAS1R2
TAS1R2 (Taste receptor type 1 member 2), a G protein-coupled receptor, is encoded by TAS1R2 gene. It is a component of the heterodimeric amino acid taste receptor T1R2+3, which mediates the perception of umami and sweet tastes and regulates metabolism. The TAS1R2 protein is functional with the formation of the 2+3 heterodimer and can be activated spontaneously without the extracellular domains and binding ligands.
| Basic Information of TAS1R2 | |
| Protein Name | Taste receptor type 1 member 2 |
| Gene Name | TAS1R2 |
| Aliases | GPR71, T1R2, TR2 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q8TE23 |
| Transmembrane Times | 7 |
| Length (aa) | 839 |
| Sequence |
MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCK EYEVKVIGYNLMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDN LLPIQEDYSNYISRVVAVIGPDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPAL LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWIA SESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPLSRTSQSYTCN QECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQL LEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQD ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPN NEWSYQSETSCFKRQLVFLEWHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAG GPMCFLMLTLLLVAYMVVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFK MASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSC NPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYFTSSVSLCTFM SAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD |
Function of TAS1R2 Membrane Protein
The TAS1R2 receptor can respond to natural sugars sucrose and fructose, and to several artificial sugars. Research conducted on rat shows that the receptors can not respond to many other natural and artificial sugars, which suggest there must be more than one type of sweet taste receptor. The TAS1R2 can also bind to the G protein, several studies confirm that TAS1R1 and TAS1R2 have also been shown to activate Gαo and Gαi, which can affect the human sweet taste receptors. Meanwhile, it can inhibit adenylyl cyclases to decrease cyclic guanosine monophosphate (cGMP) levels in taste receptors. The major SNP polymorphism in the sweet taste receptor (TAS1R2) has previously been associated with lower sugar sensitivity and higher sugar intake among overweight individuals.
Fig.1 Sweet taste receptor.
Application of TAS1R2 Membrane Protein in Literature
Authors analyze the taste receptor Tas1r2 from a species of Old World monkeys, the rhesus monkey, and results show that rhesus monkey Tas1r2 could respond to artificial sweeteners and sweet-tasting proteins.
This article analyses the SNP of the TAS1R2/TAS1R3 on sweet taste sensitivity, sensory-specific satiety (SSS) and macronutrient intake in healthy human adults, and reveals the association among specific SNP of the TAS1R2/TAS1R3 with various taste sensitivity, macronutrient appetite, and food consumption.
Authors conduct a study to evaluate the influence of polymorphisms of the sweet taste receptor gene TAS1R2 on diet and metabolic profile in obese children and adolescents. The data show that SNP allele is related to the status of dietary fiber intake.
This article studies the association between TAS1R2 polymorphisms with lean and overweight Swedish Middle-Aged individuals. Results confirm people who carry specific alleles have the higher carbohydrate intake, but no allele can be a marker of sugar intake in the MDC population.
This study aims to investigate the association of TAS1R2 (Ile191Val - rs35874116) and TAS1R3 (-1266 C/T - rs35744813) variants with food intake and nutritional status in children followed from birth until 7.7 years old. They find a genetic variant of the T1R2 taste receptor is associated with the intake of different amounts of high sugar-content foods in childhood.
TAS1R2 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAS1R2 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.