Close

TAS2R16 Membrane Protein Introduction

Introduction of TAS2R16

Taste receptor type 2 member 16 (TAS2R16) is a protein that in humans is encoded by the TAS2R16 gene, which is located on the long (q) arm of chromosome 7 at position 31.1-31.3, from base pair 122,228,764 to base pair 122,229,639. As a member of the family of taste type 2 receptors (TAS2Rs), TAS2R16 is reported to play a role in the perception of bitterness.

Basic Information of TAS2R16
Protein Name Taste receptor type 2 member 16
Gene Name TAS2R16
Aliases N/A
Organism Homo sapiens (Human)
UniProt ID Q9NYV7
Transmembrane Times 7
Length (aa) 291
Sequence MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCS
YFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVT
IIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHH
STGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSS
PTLKRILKGKC

Function of TAS2R16 Membrane Protein

Human bitter taste perception is mediated by the 25 members of the highly divergent TAS2R receptor family, which are seven transmembranes G protein-coupled receptors that are mainly expressed in specialized taste bud cells. The TAS2Rs are also expressed in the respiratory and gastrointestinal tracts and have evolved to detect the extraordinary diversity of bitter compounds that are naturally found in foods and toxins, translating that detection into gustatory perception via G protein-coupled signaling. As a member of the TAS2R receptor family, TAS2R16 is reported to respond to ~30 different β-glucoside compounds, whose molecular scaffold consists of a D-glucose monosaccharide linked by an oxygen atom to a phenyl group. During the past years, TAS2R16 specifically is believed to play a central role in determining human preference to eat or avoid foods with bitter β-glucosides, important dietary choices that ultimately influence human health.

TAS2R16 residues that define ligand specificity. Fig.1 TAS2R16 residues that define ligand specificity. (Thomas, 2017)

Application of TAS2R16 Membrane Protein in Literature

  1. Barontini J., et al. Association between polymorphisms of TAS2R16 and susceptibility to colorectal cancer. BMC Gastroenterology. 2017, 17(1): 104. PubMed ID: 28915899

    This article aims to evaluate whether polymorphic variants in TAS2R16 could affect the risk of developing this neoplasia and identify the role of TAS2R16 in modulating chronic inflammation within the gut. It suggests that polymorphisms within TAS2R16 gene do not have a strong influence on colon cancer susceptibility, but a possible role in rectal cancer should be further evaluated in larger cohorts.

  2. Thomas A., et al. The bitter taste receptor TAS2R16 achieves high specificity and accommodates diverse glycoside ligands by using a two-faced binding pocket. Scientific reports. 2017, 7(1): 7753. PubMed ID: 28798468

    This article suggests a model in which hydrophobic residues on TM3 and TM7 form a broad ligand-binding pocket that can accommodate the diverse structural features of β-glycoside ligands while still achieving high specificity.

  3. Imai H., et al. Amino acid residues of bitter taste receptor TAS2R16 that determine sensitivity in primates to β-glycosides. Biophysics and physicobiology. 2016, 13: 165-71. PubMed ID: 27924271

    This report finds that the sensitivity of TAS2R16 varied due to several amino acid residues. Mutation of amino acid residues at E86T, L247M, and V260F in human and langur TAS2R16 for mimicking the macaque TAS2R16 decreased the sensitivity of the receptor in an additive manner, which suggests its contribution to the potency of salicin, possibly via direct interaction.

  4. Imai H., et al. Functional diversity of bitter taste receptor TAS2R16 in primates. Biology Letters. 2012, 7: rsbl20111251. PubMed ID: 22399783

    This article aims to investigate the sensitivities of TAS2R16s of various primates and finds that the sensitivity of each primate species varied according to the ligand. It suggests that the possibility that bitter-taste sensitivities evolved independently by replacing specific amino acid residues of TAS2Rs in different primate species to adapt to food items they use.

  5. Bufe B., et al. The human TAS2R16 receptor mediates bitter taste in response to β-glucopyranosides. Nature genetics. 2002, 32(3): 397. PubMed ID: 12379855

    This article suggests that there is a correlation between TAS2R16 and the recognition of a specific chemical structure to the perception of bitter taste. If the ability of TAS2R16 to detect substances with common molecular properties is typical of the bitter receptor family, it may explain how a few receptors permit the perception of numerous bitter substances.

TAS2R16 Preparation Options

To provide high-quality membrane protein products to global customers, we have successfully developed an advanced MemDX™ membrane protein production platform. We are happy to work with you and promote your project a success. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAS2R16 antibody development services.


With a wealth of experience and professional scientists, Creative Biolabs is committed to offering a full range of membrane protein preparation services to meet our worldwide customers’ requirements. Except for TAS2R16 membrane protein preparation, we also offer other membrane protein products. If you are interested in the service we can provide, please feel free to contact us and get more information.

Reference

  1. Thomas, et al. (2017). The Bitter Taste Receptor TAS2R16 Achieves High Specificity and Accommodates Diverse Glycoside Ligands by using a Two-faced Binding Pocket. Scientific reports. 7(1), 7753.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us