Introduction of TAS2R7
Taste receptor type 2 member 7 (TAS2R7 or T2R7) is also known as Taste receptor family B member 4 (TRB4), which is a member of bitter taste receptors, a set of typical G-protein coupled receptors (GPCRs). Mapped to chromosome 12p13.2, TAS2R7 gene is organized in the genome in clusters and is genetically linked to loci that influence bitter perception in mice and humans. The molecular weight of TAS2R5 is predicted to be 36.5 kDa, comprising 318 amino acids. The structure of TAS2R7 is characterized by a 7-transmembrane structure and conserved short N- and C-terminal domains. Meanwhile, the intracellular domains share significant conservation with other TAS2R family members. So far, the 3D structure of TAS2R7 hasn't been determined.
| Basic Information of TAS2R7 | |
| Protein Name | Taste receptor type 2 member 7 |
| Gene Name | TAS2R7 |
| Aliases | Taste receptor family B member 4, TRB4 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9NYW3 |
| Transmembrane Times | 7 |
| Length (aa) | 318 |
| Sequence |
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFL WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI WKVMSILKGRKFQQHKQI |
Function of TAS2R7 Membrane Protein
Identified as a bitter taste receptor, TAS2R7 is exclusively expressed in subsets of taste receptor cells of the tongue, which contain the G protein subunit gustducin, implying that it is mainly expressed in gustducin-positive cells. TAS2R7 is involved in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Besides, it plays a role in sensing the chemical composition of the gastrointestinal content, stimulates alpha gustducin, mediates PLC-beta-2 activation and leads to the gating of TRPM5. Possessing G-protein coupled receptor activity, TAS2R7 mediates the transduction via a G protein-coupled second messenger pathway. Notably, TAS2R7 is the only receptor stimulated by the anthocyanin malvidin-3-glucoside.
Fig.1 Taste perception by various taste receptors. (Depoortere, 2014)
Application of TAS2R7 Membrane Protein in Literature
This article shows that both Sichuan domestic chickens and Tibetan chickens have abundant haplotypes in Tas2rs, especially in Tas2r7, which might help chickens to recognize a wide variety of bitter-tasting compounds.
This article demonstrates that rs619381 modulates the effect of taste receptor, type 2, member 7 (TAS2R7) on taste receptor activity and taste transduction (p < 0.001, FDR < 0.001; p = 0.001, FDR = 0.012).
This article identifies 12 novel non-synonymous single nucleotide variants, which were shared among 5 affected members of this family. The mutations were found in 12 different genes; DZIP1L, PCOLCE2, IGSF10, SUCNR1, OR13C8, EPB41L4B, SEC16A, NOTCH1, TRIOBP, SF3A1, GAL3ST1, and TAS2R7.
This article provides additional evidence that bitter taste-sensing mechanisms are coupled to hormone release from EC cells in the intestine. Moreover, it identified a natural agonist of TAS2R7 and TAS2R14 for further studies on the role of bitter receptors in satiety control and food intake.
This article reveals that The TAS2R7 protein is expressed in rat mesenteric and cerebral arteries, as well as in human omental arteries. Immunofluorescence imaging confirms that TAS2R7 is located in vascular smooth muscle cells and endothelial cells.
TAS2R7 Preparation Options
Our advanced MemDX™ membrane protein production platform provides many flexible options, from which you can always find the best match for your particular project. Our experienced scientists will do their best to help you find a perfect match to meet your needs. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TAS2R7 antibody development services.
With the world's broadest range of knowledge in membrane protein, Creative Biolabs applies its expertise in membrane protein production service using a variety of strategies. Based on our leading-edge platform, we have successfully produced, purified, stabilized and characterized many challenging membrane proteins for global customers. If you are interested in the services, please contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.