Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of TBXA2R
TBXA2R belongs to the G-protein coupled receptor 1 family. Encoded by TBXA2R gene, TBXA2R is composed of 407 amino acids with 7 putative transmembrane domains. TBXA2R has a broad expression in fat, spleen and 20 other tissues. The protein can interact with thromboxane A2 to induce platelet aggregation and regulate hemostasis. Mutations in this gene may result in a bleeding disorder. TBXA2R has multiple transcript variants encoding different isoforms.
| Basic Information of TBXA2R | |
| Protein Name | Thromboxane A2 receptor |
| Gene Name | TBXA2R |
| Aliases | Prostanoid TP receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | P21731 |
| Transmembrane Times | 7 |
| Length (aa) | 407 |
| Sequence |
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFL TFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMAS ERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESG DVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASV CWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQ PRLSTRPRRSLTLWPSLEYSGTISAHCNLRLPGSSDSRASASRAAGITGVSHCARPCMLFDPEF DLLAGVQLLPFEPPTGKALSRKD |
Function of TBXA2R Membrane Protein
As a powerful stimulator of platelet aggregation, TBXA2R plays an essential role in hemostasis by interacting with thromboxane A2 (TXA2), which is an arachidonate metabolite. At present, TXA2 has been well recognized as a potent stimulator of platelet aggregation and a constrictor of vascular and respiratory smooth muscles. The activity of TBXA2R is mediated by a G-protein, which can activate a phosphatidylinositol-calcium second messenger system. It is documented that when binding to glomerular TP receptors in the kidney, TXA2 will cause intense vasoconstriction. Isoform 1 of TBXA2R can activate adenylyl cyclase, however, the isoform 2 may lead to inhibition of adenylyl cyclase. This receptor has guanyl-nucleotide exchange factor activity and thromboxane A2 receptor activity. There is no experiment structure of TBXA2R available so far. TBXA2R has been implicated to be associated with various diseases such as myocardial infarction, stroke, and bronchial asthma.
Fig.1 A theoretical model of TBXA2R.
Application of TBXA2R Membrane Protein in Literature
This article demonstrates that TBXA2R strengthens TNBC cell migration, invasion and activated Rho signaling, phenotypes which could be reversed using Rho-associated Kinase (ROCK) inhibitors. TBXA2R also protects TNBC cells from DNA damage by negatively regulating reactive oxygen species levels. In summary, TBXA2R is a novel breast cancer-associated gene required for the survival and migratory behavior of a subset of TNBCs and could provide opportunities to develop novel, more effective treatments.
This article confirms ORMDL3 as a candidate gene for childhood asthma susceptibility. STAT6 and TBXA2R polymorphisms are not associated with asthma risk, but they are associated with asthma-related symptoms.
This article suggests that the TBXA2R-4684T allele may have a connection with lower TBXA2R expression, which may cause the development of the AIAU phenotype.
This article demonstrates that genetic variants identified in the TBXA2R gene may influence transcriptional activity and may be associated with asthma-related phenotypes. Thromboxane pathways may, therefore, have a significant influence on airway inflammation and remodeling in asthma patients.
This article suggests that TBXA2R +924C/T polymorphism is associated with asthma risk, and +795C/T polymorphism may be a risk factor for AIA. Larger-scale and well-designed studies are required to validate the association identified in the current meta-analysis.
TBXA2R Preparation Options
In order to provide high-quality membrane protein preparation service, we have developed versatile Magic™ membrane protein production platform. Our experienced scientists will do their best to help you find a perfect match to meet your needs. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TBXA2R antibody development services.
Creative Biolabs is dedicated to providing first-class membrane protein production service using a variety of strategies. Based on our leading-edge platform, we have successfully produced, purified, stabilized and characterized many challenging membrane proteins for global customers. If you are interested in the services, please contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
