Transmembrane protein 100 (TMEM100) is a transmembrane protein encoded by the TMEM100 gene located at 17q32. It consists of 134 amino acids (aa) and contains two transmembrane domains (amino acids 53-75, 85-107). TMEM100 is highly conserved in vertebrates and not structurally related to any known family of proteins in any species. It is expressed in various organs, such as the brain, heart, skeletal muscles and gastrointestinal tract, but mainly in the lungs. TMEM100 expression has not been reported in adult mammalian tissues, but appears in the ventral neural tube of mouse embryos and plays a role in signaling pathways in the development of the enteric nervous system. TRPA1 and TRPV1 are key pain mediators, TMEM100 is identified as a potentiating regulator of the TRPA1-V1 complex and as a candidate for the modulation of the TRPA1-V1 complex in the nociceptive pathway.
| Basic Information of TMEM100 | |
| Protein Name | Transmembrane protein 100 |
| Gene Name | TMEM100 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9NV29 |
| Transmembrane Times | 2 |
| Length (aa) | 134 |
| Sequence | MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA |
TMEM100 is involved in renal development, cardiovascular morphogenesis, pain signaling in the dorsal root ganglia, and reduction of the invasiveness of lung and liver cancer cells. TMEM100 is considered to be a marker of enteric nerves and is used to identify neuronal structures in the gastrointestinal tract. The expression of TMEM100 in the enteric nervous system can reflect the role of transforming growth factor beta, bone morphogenetic protein (BMP) or related signaling pathways in cell development and differentiation. TMEM100 knockout mice have been reported to exhibit embryonic lethality with abnormal vascular differentiation and heart morphogenesis. In addition, TMEM100 is involved in the development and progression of tumors, including invasion, migration and proliferation. TMEM100 is down-regulated in lung cancer and inhibits proliferation and metastasis of lung cancer cells by inhibiting TNF signaling pathway, which may be a potential prognostic biomarker and therapeutic target for non-small cell lung carcinoma. Moreover, it is also an independent risk factor for overall survival and disease-free survival in hepatocellular carcinoma (HCC) patients, suggesting that TMEM100 may act as a tumor suppressor in HCC metastasis and proliferation.
Fig.1 The structure of the TEME100. TEME100 is a two-transmembrane protein with a TRPA1 binding site (KRR) at its C terminus. Both the N and C termini are intracellular, while the loop region is extracellular. PM, plasma membrane. (Weng, 2015)
This article shows that TMEM100 is a new intracellular protein with two transmembrane domains whose amino acid sequence is highly conserved from fish to humans.
This study demonstrates the important role of BMP7 in Tmem100-mediated cell proliferation and apoptosis and reveals a complicated regulation network among Tmem100, BMP7, and BMPR-II in mouse embryonic kidney-derived cells.
This article suggests that TMEM100 performs various functions in response to changes in calcium signaling in addition to responding to endoplasmic reticulum stress.
This article finds that TMEM100 acts as a tumor suppressor gene by inhibiting the TNF signaling pathway and may prove to be a potential prognostic biomarker and therapeutic target for non-small-cell lung carcinoma.
The results of this study suggest that TMEM100 acts as a tumor suppressor in hepatocellular carcinoma metastasis and proliferation.
Membrane protein research has made important progress in recent years. Based on our versatile MemDX™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TMEM100 antibody development services.
During the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We hope to implement our customers' plans through our one-stop customized service. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.