Transmembrane Protein 30A (TMEM30A) is also known as CDC50A or C6orf67, which is encoded by TMEM30A gene. In silico expression analysis revealed that TMEM30A has a ubiquitous expression in brain, lung, adrenal, appendix, colon, thyroid, urinary bladder, and 19 other tissues. TMEM30A mutations are associated with Intrahepatic Cholestasis. An important paralog of TMEM30A gene is TMEM30B. There are three isoforms produced by alternative splicing: isoform 1, isoform 2, isoform 3, among which isoform 1 is chosen as the canonical sequence. It has documented that TMEM30A has 2 transmembrane domains and an extracellular loop with 3 cysteines and an N-glycosylation site.
| Basic Information of TMEM30A | |
| Protein Name | Cell cycle control protein 50A |
| Gene Name | TMEM30A |
| Aliases | P4-ATPase Flippase Complex Beta Subunit TMEM30A, C6orf67, CDC50A |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9NV96 |
| Transmembrane Times | 2 |
| Length (aa) | 361 |
| Sequence | MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI |
TMEM30A is an accessory component of a P4-ATPase flippase complex, which controls the transport of aminophospholipids from the outer to the inner leaflet of various membranes coupled to the hydrolysis of ATP to maintain the asymmetric distribution of phospholipids. ATP8A2-TMEM30A complex may play a role in the regulation of neurite outgrowth. Whereas ATP8A1-TMEM30A flippase complex seems to be involved in the mediation of cell migration. TMEM30A is indispensable for the formation of ATP8B1, ATP8B2, and ATP8A2 P-type ATPase intermediate phosphoenzyme. Additionally, it is reported that TMEM30A is involved in the uptake of synthetic drug alkylphospholipid edelfosine and platelet-activating factor (PAF). TMEM30A also regulates the export of α subunits ATP8A1, ATP10A, ATP11A, ATP8B1, ATP8B2, ATP8B4, ATP10B, ATP10D, ATP11B and ATP11C from the endoplasmic reticulum to other membrane localizations.
Fig.1 Schematic representation of TMEM30A structure in the membrane.
This article reveals that Tmem30a is a potential therapeutic target for BCR/ABL1-induced chronic myeloid leukemia.
This article demonstrates that TMEM30A deficiency will lead to intrahepatic cholestasis in mice by repressing the expression of BS transporters and related nuclear receptors, and blocking the localization of BS transporters, suggesting that TMEM30A may be a novel therapeutic target for intrahepatic cholestasis.
This article finds the genes, identified by computational biology methods, are indeed regulated by TMEM30A during cell migration, which gives a new understanding of the tumor invasion molecular basis.
This article suggests that extracellular choline phospholipids with short sn-2 residues can have sites of metabolism and intracellular roles because they are transport substrates for a TMEM30A phospholipid import system.
This article reveals that interactions between class 1 P(4)-ATPases and CDC50 proteins are required for ER exit and stability of both subunits.
In order to provide high-quality membrane protein preparation service, we have developed a versatile MemDX™ membrane protein production platform. Our experienced scientists will do their best to help you find a perfect match in your required formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TMEM30A antibody development services.
Creative Biolabs is dedicated to providing first-class membrane protein production service using a variety of strategies. Based on our leading-edge platform, we have successfully produced, purified, stabilized and characterized many challenging membrane protein targets for global customers. If you are interested in the service we can provide, please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.