Close

TMEM30B Membrane Protein Introduction

Introduction of TMEM30B

Transmembrane Protein 30B (TMEM30B), also known as CDC50B, is encoded by TMEM30B gene. This gene product is named as cell cycle control protein 50B or P4-ATPase flippase complex beta subunit TMEM30B. TMEM30B gene is located at chromosome 14 and highly conserved in Rhesus monkey, chimpanzee, mouse, cow, zebrafish, rat, and frog. TMEM30B is widely expressed in pancreatic islet, kidney, and prostate, as well as in lung carcinoid, parathyroid tumor, bladder tumor, meningioma, and pancreatic cancer. TMEM30B also has 2 transmembrane domains and an extracellular loop with 3 cysteines and an N-glycosylation site.

Basic Information of TMEM30B
Protein Name Cell cycle control protein 50B
Gene Name TMEM30B
Aliases P4-ATPase flippase complex beta subunit TMEM30B, CDC50B, Transmembrane protein 30B
Organism Homo sapiens (Human)
UniProt ID Q3MIR4
Transmembrane Times 2
Length (aa) 351
Sequence MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCILTGFVMLVVYIRYQDQDDDDEE

Function of TMEM30B Membrane Protein

The most well-known role of TMEM30B is to function as an accessory component of P4-ATPase flippase complex, which is a subfamily of P-type ATPases that flip phospholipids across membranes to generate lipid asymmetry, a property vital to many cellular processes. Mutations in several P4-ATPases have been linked to severe neurodegenerative and metabolic disorders. In addition, TMEM30B contributes to the maintenance of the asymmetric distribution of phospholipids and the uptake of lipid signaling molecules and vesicle formation. Moreover, TMEM30B can regulate the export of α subunits ATP8B1, ATP8A1, ATP8B2, and ATP8B4 from the endoplasmic reticulum to the plasma membrane. Other functions of TMEM30B are still unknown clearly. Diseases associated with TMEM30B include Meningioma and Familial.

A structure model of TMEM30B in ModBase. Fig.1 A structure model of TMEM30B in ModBase. (Ursula, 2014)

Application of TMEM30B Membrane Protein in Literature

  1. Coleman J.A. and Molday R.S. Critical role of the beta-subunit CDC50A in the stable expression, assembly, subcellular localization, and lipid transport activity of the P4-ATPase ATP8A2. J Biol Chem. 2011, 286(19):17205-16. PubMed ID: 21454556

    This article reveals that ATP8A2 in HEK293T cells assembles with CDC50A, but not CDC50B, to generate a heteromeric complex that actively transports phosphatidylserine and phosphatidylethanolamine across membranes.

  2. Katoh Y., et al. Identification and characterization of CDC50A, CDC50B and CDC50C genes in silico. Oncol Rep. 2004, 12(4):939-43. PubMed ID: 15375526

    This article identifies and characterizes CDC50A, CDC50B(TMEM30B), CDC50C genes of human and mouse in silico.

  3. Paulusma C.C., et al. ATP8B1 requires an accessory protein for endoplasmic reticulum exit and plasma membrane lipid flippase activity. Hepatology. 2008, 47(1):268-78. PubMed ID: 17948906

    This article indicates that CDC50 proteins are critical factors in the transport of ATP8B1 to the plasma membrane and thus may be necessary genetic determinants of ATP8B1-related disease.

TMEM30B Preparation Options

In order to provide high-quality membrane protein preparation service, we have developed a versatile MemDX™ membrane protein production platform. Our experienced scientists will do their best to help you find a perfect match in your required formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TMEM30B antibody development services.


Creative Biolabs is dedicated to providing first-class membrane protein production service using a variety of strategies. Based on our leading-edge platform, we have successfully produced, purified, stabilized and characterized many challenging membrane protein targets for global customers. If you are interested in the service we can provide, please feel free to contact us for more information.

Reference

  1. Ursula Pieper, et al. (2014). MODBASE, a database of annotated comparative protein structure models and associated resources. Acids Research. 42: D336-46.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us