Introduction of TSHR
TSHR is encoded by TSHR gene. It belongs to a member of the glycoprotein hormone family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. TSHR binds with thyroid stimulating hormone (TSH) to help thyroid epithelial cell proliferation, to regulate the expression of differentiation markers such as thyroglobulin, thyroperoxidase, and the sodium iodide symporter (NIS). It can also be endogenously activated by hormone ghrelin and autoantibodies.
| Basic Information of TSHR | |
| Protein Name | Thyrotropin receptor |
| Gene Name | TSHR |
| Aliases | LGR3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P16473 |
| Transmembrane Times | 7 |
| Length (aa) | 764 |
| Sequence |
MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHL RTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLL KFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSV QGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARN TWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSMQSLRQRKSVNALNS PLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETLQAFDSH YDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNVFVLLILLTSHYKLNV PRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQTGPGCNTAGFFTVFASELSVYTL TVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTET PLALAYIVFVLTLNIVAFVIVCCCYVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAPI SFYALSAILNKPLITVSNSKILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQ AYRGQRVPPKNSTDIQVQKVTHDMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL |
Function of TSHR Membrane Protein
The TSH receptor (TSHR) plays an important role in some thyroid conditions, particularly in well-differentiated thyroid carcinoma remnants following incompletely ablative therapy (surgery and radioiodine). TSHR has been reported to be expressed in normal liver tissues and be associated with several diseases, such as hepatocellular carcinoma (HCC). Recent studies show that TSHR antibodies cause autoimmune hyperthyroidism and are prevalent in patients with related thyroid eye disease (TED), which is a promising molecular diagnostic marker and novel therapeutic target in the clinic.
Fig.1 Structure of TSHR membrane protein.
Application of TSHR Membrane Protein in Literature
This article crystallizes the CS-17 Fab and determines its atomic structure at 3.4 Å resolution, which is beneficial to the development of a molecule with therapeutic potential in thyroid carcinoma.
This article analyses the Paired cancerous and non-cancerous HCC tissues and the exon-10 of TSHR, thus trying to assess the expression level of TSHR in hepatocellular carcinoma (HCC). These results indicate that TSHR is overexpressed in HCC tissues which are associated with unfavorable prognosis.
Authors review the recent articles on various immunoassays of TSHR antibodies in TED patients and their clinical applications, and these results confirm that thyroid stimulating hormone receptor (TSHR) antibodies, especially the functional stimulating antibodies, are sensitive, specific, and reproducible biomarkers for patients with autoimmune TED.
This article focuses on finding the relationship between the TSHR, PAX8, and PDE4B gene CNVs and TSH abnormalities by calculating variations in gene copy number. These results suggest the TSHR gene CNV is associated with the development of TSH abnormalities.
This article conducts a case-control study in an infant of a mother with autoimmune hypothyroidism with positive TSH receptor antibodies, and the result shows that maternal history of any thyroid disorder may increase the risk of transmission to an infant, which is important to guide the pregnancy.
TSHR Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TSHR antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.