Close

TSHR Membrane Protein Introduction

Introduction of TSHR

TSHR is encoded by TSHR gene. It belongs to a member of the glycoprotein hormone family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. TSHR binds with thyroid stimulating hormone (TSH) to help thyroid epithelial cell proliferation, to regulate the expression of differentiation markers such as thyroglobulin, thyroperoxidase, and the sodium iodide symporter (NIS). It can also be endogenously activated by hormone ghrelin and autoantibodies.

Basic Information of TSHR
Protein Name Thyrotropin receptor
Gene Name TSHR
Aliases LGR3
Organism Homo sapiens (Human)
UniProt ID P16473
Transmembrane Times 7
Length (aa) 764
Sequence MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHL
RTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLL
KFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSV
QGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARN
TWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSMQSLRQRKSVNALNS
PLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETLQAFDSH
YDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNVFVLLILLTSHYKLNV
PRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQTGPGCNTAGFFTVFASELSVYTL
TVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTET
PLALAYIVFVLTLNIVAFVIVCCCYVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAPI
SFYALSAILNKPLITVSNSKILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQ
AYRGQRVPPKNSTDIQVQKVTHDMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL

Function of TSHR Membrane Protein

The TSH receptor (TSHR) plays an important role in some thyroid conditions, particularly in well-differentiated thyroid carcinoma remnants following incompletely ablative therapy (surgery and radioiodine). TSHR has been reported to be expressed in normal liver tissues and be associated with several diseases, such as hepatocellular carcinoma (HCC). Recent studies show that TSHR antibodies cause autoimmune hyperthyroidism and are prevalent in patients with related thyroid eye disease (TED), which is a promising molecular diagnostic marker and novel therapeutic target in the clinic.

TSHR Membrane Protein IntroductionFig.1 Structure of TSHR membrane protein.

Application of TSHR Membrane Protein in Literature

  1. Chen C.R., et al. Structure of a TSH receptor monoclonal antibody variable region provides insight into potential mechanisms for its inverse agonist activity. Thyroid. 2018, 28(7):933-940. PubMed ID: 29845889

    This article crystallizes the CS-17 Fab and determines its atomic structure at 3.4 Å resolution, which is beneficial to the development of a molecule with therapeutic potential in thyroid carcinoma.

  2. Shih Y.L., et al. Identification of Functional Thyroid Stimulating Hormone Receptor and TSHR Gene Mutations in Hepatocellular Carcinoma. Anticancer Res. 2018, 38(5), 2793-2802. PubMed ID: 29439317

    This article analyses the Paired cancerous and non-cancerous HCC tissues and the exon-10 of TSHR, thus trying to assess the expression level of TSHR in hepatocellular carcinoma (HCC). These results indicate that TSHR is overexpressed in HCC tissues which are associated with unfavorable prognosis.

  3. Diana T., et al. Thyroid Stimulating Hormone Receptor Antibodies in Thyroid Eye Disease-Methodology and Clinical Applications. Ophthalmic Plast Reconstr Surg. 2018, 34(4S Suppl 1):S13-S19. PubMed ID: 29771755

    Authors review the recent articles on various immunoassays of TSHR antibodies in TED patients and their clinical applications, and these results confirm that thyroid stimulating hormone receptor (TSHR) antibodies, especially the functional stimulating antibodies, are sensitive, specific, and reproducible biomarkers for patients with autoimmune TED.

  4. Pang Y., et al. Association of TSHR Gene Copy Number Variation with TSH Abnormalities. Biol Trace Elem Res. 2018, 186(1):85-90. PubMed ID: 29546542

    This article focuses on finding the relationship between the TSHR, PAX8, and PDE4B gene CNVs and TSH abnormalities by calculating variations in gene copy number. These results suggest the TSHR gene CNV is associated with the development of TSH abnormalities.

  5. Joshi K., et al. Hyperthyroidism in an infant of a mother with autoimmune hypothyroidism with positive TSH receptor antibodies. J Pediatr Endocrinol Metab. 2018, 31(5), 577-580. PubMed ID: 29494342

    This article conducts a case-control study in an infant of a mother with autoimmune hypothyroidism with positive TSH receptor antibodies, and the result shows that maternal history of any thyroid disorder may increase the risk of transmission to an infant, which is important to guide the pregnancy.

TSHR Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TSHR antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us