Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsThe Vesicle-associated membrane protein 2 encoded by VAMP2 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP2 is a key part of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) that is involved in synaptic vesicle exocytosis, a fundamental step in neurotransmitter release between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, and synaptotagmin. It also forms a distinct complex with synaptophysin. Besides, VAMP2 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
| Basic Information of VAMP2 | |
| Protein Name | Vesicle-associated membrane protein 2 (VAMP-2) |
| Gene Name | VAMP2 |
| Aliases | Synaptobrevin-2 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P63027 |
| Transmembrane Times | 1 |
| Length (aa) | 116 |
| Sequence | MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST |
VAMP2 plays a crucial role in membrane fusion, mediating protein trafficking and the secretion of physiological mediators. Except that, the VAMP2 plays vital roles in other processes. VAMP2 can function as a molecular marker for both quiescent satellite cells and myotubes, but not for proliferating myoblasts. Thyroid hormone may promote glucose uptake via enhancing insulin-induced phosphorylation of Akt and subsequent translocations of VAMP2 and GLUT4 in 3T3-L1 adipocytes. Additionally, by reducing VAMP2 expression in a murine model of epilepsy, mice showed significant reductions in potassium-evoked glutamate release, which leads to a kindling-resistant phenotype. Because VAMP2 gene encodes a synaptic vesicle protein and its special map location, it may play role in the pathogenesis of Familial Infantile Myasthenia Gravis (FIMG).
Fig.1 A model for tethering and fusion of Tfn-TfnR-containing recycling vesicles with the PM, mediated by Rab11, the exocyst and SNAREs. (Kubo, 2015)
This article finds that cAMP stimulation enhances VAMP2 exocytosis and promotes VAMP2 interaction with NKCC2.
This article suggests that VAMP2-NRG1 fusion gene, in particular, its most dominant splice variant, is capable of promoting cellular growth and thus likely functions as an oncogene.
This article suggests that the distribution of SNAP25, VAMP1 and VAMP2 is age-related and submitted to estrogenic control during development. Changes in SNAP25, VAMP1 and VAMP2 in defined nerve terminals could correlate with alterations of specific synaptic properties.
This article reveals an essential role for AP180-mediated high-fidelity sorting of Syb2 in SV reformation and neurotransmission.
This article suggests that the Aβ-miR-34cVAMP2 pathway partially explains the mechanism underlying VAMP2 reduction in AD patients.
Membrane protein studies have advanced significantly over the past few years. Based on our versatile Magic™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-VAMP2 antibody development services.
During the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are happy to accelerate the development of our clients’ programs with our one-stop, custom-oriented service. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
