Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of XCR1
XCR1 is encoded by XCR1 gene. It belongs to the G protein-coupled receptor superfamily which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. XCR1 can increase the intracellular calcium ions level and is most closely related to RBS11 and the MIP1-alpha/RANTES receptor. XCL1-XCR1 axis plays an important role in the dendritic-cell-mediated cytotoxic immune response. It has also reported that XCL1 and XCR1 are constitutively expressed in the thymus and regulate the thymic establishment of self-tolerance and the generation of regulatory T cells.
| Basic Information of XCR1 | |
| Protein Name | Chemokine XC receptor 1 |
| Gene Name | XCR1 |
| Aliases | CCXCR1, GPR5 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P46094 |
| Transmembrane Times | 7 |
| Length (aa) | 333 |
| Sequence |
MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYESLES LTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFLTIMTIHRY LSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSELTWYLTSVYQHNL FFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGPYNFTLFLQTLFRTQII RSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKHVLRQFWFCRLQAPSPASIPH SPGAFAYEGASFY |
Function of XCR1 Membrane Protein
XCR1, the only receptor for XCL1, is expressed on a subset of dendritic cell (DC). XCR1 mRNA is selectively expressed in “conventional” DCs, and not in resting or activated T cells, B cells, NK cells, or plasmacytoid DCs (pDCs). XCR1 can be expressed in several tissues, such as spleen, lymph nodes, and paracortical areas. Many studies conducted on XCR1 demonstrate that it is involved in antigen cross-presentation and plays a vital role in many biological functions. Meanwhile, Recent studies show that XCR1 can be used for vaccination purposes owing to the exquisite specificity of XCR1 expression.
Fig.1 Chemokine-receptor interactions. (Moser, 2004)
Application of XCR1 Membrane Protein in Literature
This article conducts a study on human first-trimester to identify the expression pattern of chemokine XCL1 and its receptor XCR1 by qRT-PCR. The result shows that XCR1 mRNA is highly expressed in the first-trimester decidua and villi, and XCL1-XCR1 chemokine pathway can help trophoblast invasion by increasing matrix metalloproteinase activity.
Authors investigate the expression level of XCL1-XCR1 axis in nociceptive processing. These results indicate that XCR1 can be a potential target for novel analgesics.
Authors in this group analyze the expression levels of 58 human chemokines/chemokine receptors in hepatocellular carcinoma (HCC). The data show that the down-regulation of XCR1 promotes the development and progression of HCC.
This article evaluates the immunogenicity of bivalent protein structures in pigs, which made of XCL1 fused to the external portion of the influenza virus M2 proton pump. The result suggests that M2e-targeting to XCR1 shows promises for a trans-species universal influenza vaccine strategy, possibly avoiding the use of classical adjuvants.
This article tries to find the function of XCR1 in breast cancer cells. These results indicate that XCR1 can affect the biological characteristics of some special breast cancer cells through a complex signal transduction pathway.
XCR1 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-XCR1 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
