Close
Close

Magic™ Membrane Protein Human ATP5PF (ATP synthase peripheral stalk subunit F6) for Antibody Discovery (CAT#: MP0091X)

Datasheet
This product is a 37.62 kDa Human ATP5PF membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP5PF
  • Protein Length
  • Full-length
  • Molecular Weight
  • 39 kDa
  • Sequence
  • MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • ATP5PF
  • Full Name
  • ATP synthase peripheral stalk subunit F6
  • Introduction
  • Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo complex has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the Fo complex. The F6 subunit is required for F1 and Fo interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has 1 or more pseudogenes
  • Alternative Names
  • ATP5; ATP5A; ATPM; CF6; F6; OTTHUMP00000096107; OTTHUMP00000096108; OTTHUMP00000096110; OTTHUMP00000096111; OTTHUMP00000096112; mitochondrial ATP synthase; coupling factor 6; mitochondrial ATP synthase; subunit F6; mitochondrial ATPase coupling factor 6; proliferation-inducing protein 36

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us