Close
Close

Magic™ Membrane Protein Human CCR8 (C-C motif chemokine receptor 8) for Antibody Discovery (CAT#: MP1337J)

Datasheet
This product is a 41.7 kDa Human CCR8 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR8
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41.7 kDa
  • TMD
  • 7
  • Sequence
  • MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR8
  • Full Name
  • C-C motif chemokine receptor 8
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. This gene is located at the chemokine receptor gene cluster region.
  • Alternative Names
  • C C chemokine receptor type 8; C C CKR 8; C C motif chemokine receptor 8; C-C chemokine receptor type 8; C-C CKR-8; CC chemokine receptor 8; CC chemokine receptor CHEMR1; CC chemokine receptor type 8; CC CKR 8; CC-CKR-8; CCR 8; CCR-8; Ccr8; CCR8 protein; CCR8-L; CCR8_HUMAN; CDw198; CDw198 antigen; Chemokine (C C motif) receptor 8; Chemokine (C C) receptor 8; Chemokine (C C) receptor like 2; Chemokine (CC motif) receptor 8; Chemokine (CC) receptor 8; Chemokine (CC) receptor like 1; Chemokine (CC) receptor like 2; Chemokine C C motif receptor 8; Chemokine C C receptor 8; Chemokine CC motif receptor 8; Chemokine CC receptor 8; Chemokine receptor 8; Chemokine receptor like 1; Chemokine receptor-like 1; CKR L1; CKR-L1; CKRL 1; CKRL1; CMKBR 8; CMKBR L2; CMKBR8; CMKBRL 2; CMKBRL2; CY 6; CY6; GPR CY6; GPR-CY6; GPRCY6; MGC123958; MGC123959; MGC129966; MGC129973; TER 1; TER1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us