Magic™ Membrane Protein Human KCNA1 (Potassium voltage-gated channel subfamily A member 1) expressed in E.coli for Antibody Discovery (CAT#: MP1374J)

Datasheet

This product is a 22.2 kDa Human KCNA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

Host Species
Human

Target Protein
KCNA1

Protein Length
Partial (1-154aa)

Protein Class
Ion Channel

Molecular Weight
22.2 kDa

Sequence
MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW

Product Description

Expression Systems
E.coli

Tag
N-6xHis

Reconstitution
Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).

Purity
>90% as determined by SDS-PAGE

Buffer
Liquid: Tris/PBS-based buffer, 5%-50% glycerol
Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

Target Protein
KCNA1

Full Name
Potassium voltage-gated channel subfamily A member 1

Introduction
This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK).

Alternative Names
AEMK; EA1; Episodic ataxia with myokymia; HBK1; HUK1; Kca1 1; Kcna1; KCNA1_HUMAN; Kcpvd; KV1.1; MBK1; mceph; MGC124402; MGC126782; MGC138385; MK1; MK1, mouse, homolog of KV1.1; Potassium channel protein 1; Potassium voltage gated channel shaker related subfamily member 1; Potassium voltage gated channel subfamily A member 1; Potassium voltage gated channel, shaker related subfamily, member 1 (episodic ataxia with myokymia); Potassium voltage-gated channel subfamily A member 1; RBK1; RCK1; Shak; Shaker related subfamily member 1; Voltage gated potassium channel subunit Kv1.1; Voltage-gated K(+) channel HuKI; Voltage-gated potassium channel HBK1; Voltage-gated potassium channel subunit Kv1.1

Gene ID
3736

UniProt ID
Q09470

Customer reviews and Q&As Write a review Ask a question

Related Products

Online Inquiry

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: