Close

Magic™ Membrane Protein Human AGTR1 (Angiotensin II receptor type 1) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (297-359aa) (CAT#: MPX4346K)

This product is a 9.2kDa Human AGTR1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AGTR1
  • Protein Length
  • Partial (297-359aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 9.2kDa
  • TMD
  • 7
  • Sequence
  • LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • AGTR1
  • Full Name
  • Angiotensin II receptor type 1
  • Introduction
  • Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B; type-1B angiotensin II receptor; AGTR1; Angiotensin II receptor type 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us