Close

Magic™ Membrane Protein Human KIR3DS1 (Killer cell immunoglobulin like receptor, three Ig domains and short cytoplasmic tail 1) Expressed in CHO for Antibody Discovery, Partial (22-340aa) (CAT#: MPX0504K)

This product is a 61.9 kDa Human KIR3DS1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KIR3DS1
  • Protein Length
  • Partial (22-340aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 61.9 kDa
  • TMD
  • 1
  • Sequence
  • HMGGQDKPFLSAWPSAVVPRGGHVTLRCH
    YRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHP
    HSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMF
    EHFFLHREWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVT
    HTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSY
    DMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
    PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLH

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • KIR3DS1
  • Full Name
  • Killer cell immunoglobulin like receptor, three Ig domains and short cytoplasmic tail 1
  • Introduction
  • Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • KIR3DS1; KIR-G1; NKAT10; CD158E2; NKAT-10; KIR-123FM; killer cell immunoglobulin-like receptor 3DS1; killer cell immunoglobulin-like receptor KIR3DS1; killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1; natural killer-associated transcript 10; Killer cell immunoglobulin like receptor, three Ig domains and short cytoplasmic tail 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us