Close

Magic™ Membrane Protein Human FCGR2A (Fc fragment of IgG receptor IIa) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3799K)

This product is a Human FCGR2A membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGR2A
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FCGR2A
  • Full Name
  • Fc fragment of IgG receptor IIa
  • Introduction
  • This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • FCGR2A; CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc gamma receptor RIIa3; Immunoglobulin G Fc receptor II; fc-gamma-RIIa; fcRII-a; igG Fc receptor II-a; Fc fragment of IgG receptor IIa

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us