Close

Magic™ Membrane Protein Human TNFRSF17 (TNF receptor superfamily member 17) Expressed in NS0 for Antibody Discovery, Partial (1-54aa) (CAT#: MPX0204K)

This product is a 32 kDa Human TNFRSF17 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF17
  • Protein Length
  • Partial (1-54aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 32 kDa
  • TMD
  • 1
  • Sequence
  • MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK
    GTNA

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TNFRSF17
  • Full Name
  • TNF receptor superfamily member 17
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
  • Alternative Names
  • TNFRSF17; BCM; BCMA; CD269; TNFRSF13A; tumor necrosis factor receptor superfamily member 17; B cell maturation antigen; B-cell maturation factor; B-cell maturation protein; TNF receptor superfamily member 17

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us