Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Creative Biolabs is one of the world’s leading contract organizations (CRO) that has extensive experience in preclinical drug discovery. Our employees are at the core of our success, with the ambition to improving health and increasing access to quality health solutions worldwide. We believe when curious, courageous and collaborative people like you are brought together, a big difference will be made for the development of innovate medicines.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
The 5-HT1A (5-HydroxyTryptamine Receptor 1A) receptor is a subtype of serotonin (5- hydroxytryptamin) receptor located in presynaptic and postsynaptic regions. This receptor plays a role in the regulation of dopamine and serotonin levels in the brain, and thereby affects neural activity, mood and behavior. The 5-HT1A receptors are G-protein coupled receptors that exert their effects through Gi/o proteins to inhibit adenylyl cyclase, as well as other second messenger cascades such as MAPK pathway. The activation of this receptor has been involved in the mechanism of action of anxiolytic, antidepressant and antipsychotic medications.
Product Specifications
Host Species
Mouse
Target Protein
HTR1A
Protein Length
Full Length
Protein Class
GPCR class A
Molecular Weight
46.1 kDa
TMD
7
Sequence
MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGT SFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGN SKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC R
Cell-free expression system in the presence of lipid vesicles
Tag
Histidine tag fused to the N-terminal end of the protein
Protein Format
Proteoliposome
Purification
Sucrose gradient
Purity
>50% by SDS-Page and Coomassie Blue staining
Buffer
Tris 50mM, pH 7.5
Target
Target Protein
HTR1A
Full Name
5-hydroxytryptamine (serotonin) receptor 1A
Introduction
This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of this gene in mice results in behavior consistent with an increased anxiety and stress response.