Close

Magic™ Membrane Protein Human FCGR3A (Fc fragment of IgG receptor IIIa) Full Length (CAT#: MPC1909K) Made to Order

This product is a 29 kDa Human FCGR3A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGR3A
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 29 kDa
  • TMD
  • 1
  • Sequence
  • MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGA
    YSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPV
    QLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKY
    FHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTIS
    SFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD
    PQDK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • FCGR3A
  • Full Name
  • Fc fragment of IgG receptor IIIa
  • Introduction
  • This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • FCGR3A; CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; FCGRIII; FCRIIIA; low affinity immunoglobulin gamma Fc region receptor III-A; CD16a antigen; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc gamma receptor III-A; Fc-gamma RIII-alpha; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD16); FcgammaRIIIA; igG Fc receptor III-2; immunoglobulin G Fc receptor III; low affinity immunoglobulin gamma receptor III-a Fc fragment; neutrophil-specific antigen NA; Fc fragment of IgG receptor IIIa

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us