Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of CLIC4
Chloride intracellular channel 4 (CLIC4) protein is encoded by the CLIC4 gene, which is a member of the p64 family and found in many tissues. The CLIC4 gene exhibits an intracellular vesicular pattern in PANC-1 cells (pancreatic cancer cells). Gene ontology annotations associated with this gene include chloride channel activity and voltage-gated chloride channel activity. An important paralog of this gene is CLIC5. Chloride channels are a diverse group of proteins which regulate basic cellular processes. Chloride channels stabilize cell membrane potential, transepithelial transport, maintain intracellular pH and regulate cell volume. Related pathways of CLIC4 include hepatic ABC transporters and activation of cAMP-dependent PKA.
| Basic Information of CLIC4 | |
| Protein Name | Chloride intracellular channel protein 4 |
| Gene Name | CLIC4 |
| Aliases | Intracellular chloride ion channel protein p64H1 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9Y696 |
| Transmembrane Times | 1 |
| Length (aa) | 253 |
| Sequence | MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK |
Function of CLIC4 Membrane Protein
High cell proliferation rate, migration, and invasiveness are specific properties of tumorigenesis, which involves chloride channels. CLIC4 is present in the mitochondrial membrane, cytoplasm, and nucleus as a soluble protein. CLIC4 is expressed in the mitochondria and regulates intracellular pH and cell volume. Under normal physiological conditions, CLIC4 is localized in the nucleus through the nuclear localization signal (NLS). The functional activity of CLIC4 is determined by its redox state: oxidant conditions enhance its membrane binding capacity and channel activity. CLIC4 is also involved in multiple cellular processes such as apoptosis, inflammation and endothelial tubulogenesis. However, CLIC4 is almost absent in normal stromal tissues and highly expressed in cancer tissues and tumor-related stromal fibroblasts. CLIC4 may be a potential target for certain cancers.
Fig.1 Structure of the CLIC4 protein.
Application of CLIC4 Membrane Protein in Literature
The article reveals that siRNA-induced down-regulation of CLIC4 could enhance proliferation, while in turn promoting apoptosis of mouse liver cancer Hca-F and Hca-P cells.
The article indicates that CLIC4 and Ihh can be used as biomarkers for the diagnostic of pancreatic ductal adenocarcinoma, including progression, metastasis, and invasiveness.
Authors in this group demonstrated that CLIC4 is not essential for collaterogenesis but is required for perinatal maturation of nascent collaterals.
This article focuses on the possible role of CLIC4 in cell adhesion and β1 integrin trafficking. CLIC4 was defined as a modulator of Rab35 activity and serum- and LPA-dependent integrin trafficking.
This article reports that CLIC4 expression is regulated particularly in fetal liver, thymus, kidney, brain, and heart, as well as developing brown adipose tissue and stratifying epidermis during the second and third trimesters.
CLIC4 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CLIC4 antibody development services.
As a leading service provider, Creative Biolabs is proud to present our professional service in membrane protein preparation and help you with the research of membrane proteins. Please do not hesitate to inquire us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
