Close

RRH Membrane Protein Introduction

Introduction of RRH

Visual pigment-like receptor peropsin (RRH), a member of visual pigment-like receptors, is a protein is encoded by the RRH gene in human. It is an important opsin and belongs to the guanine nucleotide-binding protein (G protein)-coupled receptors. Peropsin genes have seven-exons including neuropsin and RGR-opsin genes. The peropsins are one of the four subgroups of the Go/RGR opsins, including Go-opsins, RGR-opsins, peropsins, and neuropsins.

Basic Information of RRH
Protein Name Visual pigment-like receptor peropsin
Gene Name RRH
Aliases /
Organism Homo sapiens (Human)
UniProt ID O14718
Transmembrane Times 7
Length (aa) 337
Sequence MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTKMSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKKFRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI

Function of RRH Membrane Protein

Visual pigment-like receptor peropsin is one of the G protein-coupled receptors (GPCR). It has been reported that RRH can regulate RPE physiology by detecting light directly or monitoring the concentration of retinoids/other photoreceptor-derived compounds. It also participates in the activity of G-protein coupled receptor signaling pathway, as well as phototransduction, protein-chromophore linkage, and visual perception.

RRH Membrane Protein Introduction Fig. 1 Gene expression pattern of the RRH gene.

Application of RRH Membrane Protein in Literature

  1. Bellingham J., et al. In silico characterization and chromosomal localization of human RRH (peropsin)--implications for opsin evolution. BMC Genomics. 2003, 4(1):3. PubMed ID: 12542842

    The authors show that these lineages comprise the "classical opsin superfamily" which includes the rod and cone opsins, pinopsin, VA-opsin, parapinopsin and encephalopsin, the RRH and RGR group, and the melanopsin line. Relationship between RRH and RGR suggests that peropsin may function as a retinal isomerase.

  2. Ksantini M., et al. RRH, encoding the RPE-expressed opsin-like peropsin, is not mutated in retinitis pigmentosa and allied diseases. Ophthalmic Genet. 2007, 28(1):31-7. PubMed ID: 17454745

    This article demonstrates that variants of RRH truncate the last two transmembrane-spanning fragments and the Lys284, except for the disease phenotype. It also concludes that RRH is not a frequent gene in retinitis pigmentosa.

  3. Nagata T., et al. Identification and characterization of a protostome homologue of peropsin from a jumping spider. J Comp Physiol A Neuroethol Sens Neural Behav Physiol. 2010, 196(1):51-9. PubMed ID: 19960196

    The results show that peropsin exists before the deuterostome-protostome split like other members of the opsin family. Moreover, the spider peropsin and fluorescence from retinal chromophore are found in the same region.

  4. Rivolta C., et al. Mutation screening of the peropsin gene, a retinal pigment epithelium specific rhodopsin homolog, in patients with retinitis pigmentosa and allied diseases. Mol Vis. 2006, 12:1511-5. PubMed ID: 17167409

    This article indicates that the peropsin gene is not an original cause of RP or some related retinal degenerations.

  5. Cook J.D., et al. Peropsin modulates transit of vitamin A from retina to retinal pigment epithelium. J Biol Chem. 2017, 292(52):21407-21416. PubMed ID: 29109151

    The article suggests that peropsin can control all-trans-ROL movement from the retina to the RPE and may be in charge of all-trans-ROL storage within the RPE. Peropsin can affect light-dependent regulation of all-trans-ROL uptake between photoreceptors and RPE cells.

RRH Preparation Options

We keep in a leading position of membrane protein studies over the past few years. Based on our versatile MemDX™ membrane protein production platform, we can provide a series of advanced membrane protein preparation services in reconstitution forms as well as multiple active formats for worldwide customers. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-RRH antibody development services.


During the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. It’s our responsibility to boost the development of our clients’ programs with our experienced service. For more details, please feel free to contact us.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us