Close

SLC2A14 Membrane Protein Introduction

Introduction of SLC2A14

Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14), also known as Glucose transporter type 14 (GLUT-14), is a protein that in humans is encoded by the SLC2A14 gene. It is a member of the glucose transporter (GLUT) family, which consists of highly conserved integral membrane proteins that transport hexoses such as glucose and fructose into all mammalian cells.

Basic Information of SLC2A14
Protein Name Solute carrier family 2, facilitated glucose transporter member 14
Gene Name SLC2A14
Aliases Glucose transporter type 14, GLUT-14
Organism Homo sapiens (Human)
UniProt ID Q8TDB8
Transmembrane Times 12
Length (aa) 535
Sequence MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV

Function of SLC2A14 Membrane Protein

As a member of the GLUTs family, SLC2A14 (GLUT14) contains 12 putative membrane-spanning helices along with sugar-transporter signature motifs that have previously been shown to be essential for sugar transport activity. To date, two alternatively spliced forms of GLUT14 have been identified, namely GLUT14-S and GLUT14-L. The shorter form of GLUT14 (GLUT14-S) consists of 10 exons and produces a 497-amino-acid protein that is 94.5% identical to GLUT3. The long form (GLUT14-L) has an additional exon and codes for a protein with 520 amino acids that differ from GLUT14-S only at the N-terminus. Studies have shown that GLUT14 is expressed in tissues other than testis and could play a role in the development of common disease such as leukemia and Parkinson’s disease. Furthermore, variations in the SLC2A14 locus are implicated in common diseases of the central nervous system, lymphatic cancer, rheumatoid arthritis, and intraocular pressure in primary open-angle glaucoma.

Schematic structure of GLUT family glucose transporter proteins.Fig.1 Schematic structure of GLUT family glucose transporter proteins. (Malenda, 2013)

Application SLC2A14 of Membrane Protein in Literature

  1. Wang W., et al. Genetic association of SLC2A14 polymorphism with Alzheimer’s disease in a Han Chinese population. Journal of Molecular Neuroscience. 2012, 47(3):481-4. PubMed ID: 22421804

    This article aims to evaluate the involvement of the SLC2A14 polymorphism in the risk of developing late-onset Alzheimer's disease (LOAD) in Chinese. It suggests that SLC2A14 polymorphism has a possible role in changing the genetic susceptibility to LOAD in a Han Chinese population.

  2. Wu X. and Freeze H.H. GLUT14, a duplicon of GLUT3, is specifically expressed in testis as alternative splice forms. Genomics. 2002, 80(6):553-7. PubMed ID: 12504846

    This article suggests that the GLUT family is probably emerged by gene duplications and mutations during evolution in different lineages.

  3. Berlth F., et al. Both GLUT-1 and GLUT-14 are independent prognostic factors in gastric adenocarcinoma. Annals of surgical oncology. 2015, 22(3):822-31. PubMed ID: 26183839

    This article suggests that detection of GLUT-1 and GLUT-14 is of high prognostic value, which gives additional information to UICC stages and identifies patients with an inferior prognosis.

SLC2A14 Preparation Options

To provide high-quality membrane protein products, we have developed an advanced MemDX™ membrane protein production platform which enables many options, from which we will find you the perfect one. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC2A14 antibody development services.


Creative Biolabs is confident in promoting global customers’ programs. In addition to SLC2A14 membrane protein products, we also provide other membrane protein preparation services to meet every client’s specific requirements. To learn more information, please feel free to contact us for more information.

Reference

  1. Malenda, et al. (2013). Znaczenie metabolizmu glukozy w diagnostyce oraz terapii nowotworów układów krwiotwórczego i chłonnego. Hematologia. 4(3): 227-238.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us