Close

ACKR3 Membrane Protein Introduction

Introduction of ACKR3

ACKR3, previously known as receptor dog cDNA 1 (RDC-1), was recently renamed atypical chemokine receptor 3. The protein is predicted to be a seven transmembrane protein. ACKR3 is widely expressed in the hematopoietic system, heart, vascular endothelial cells, bone, kidney, and brain. ACKR3 acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. The C terminus of ACKR3 is reported to influence the ligand-uptake/degradation rate, G protein coupling, and receptor stability. NF-κB is necessary for the high expression of ACKR3 and is recruited to the proximal promoter of the ACKR3 gene.

Basic Information of ACKR3
Protein Name Atypical chemokine receptor 3
Gene Name ACKR3, CMKOR1, CXCR7, GPR159, RDC1
Aliases C-X-C chemokine receptor type 7 (CXC-R7, CXCR-7), Chemokine orphan receptor 1, G-protein coupled receptor 159, G-protein coupled receptor RDC1 homolog (RDC-1)
Organism Homo sapiens (Human)
UniProt ID P25106
Transmembrane Times 7
Length (aa) 362
Sequence MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

Function of ACKR3 Membrane Protein

ACKR3 may be involved in G-protein coupled receptor protein signaling pathway, and play roles in the pathobiological process including cell growth, survival, adhesion, tumor growth. ACKR3 can act as a coreceptor with CXCR4 to regulate its protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, ACKR3 transduces signals via the MEK/ERK pathway, mediating resistance to apoptosis. In normal hematopoietic progenitor cells, ACKR3 is not involved in cell migration, adhesion or proliferation; but it can be activated by CXCL11 in malignant blood cells, leading to phosphorylation of erk1/2 (MAPK3/MAPK1), enhancing cell adhesion and migration. ACKR3 promotes the initiation and progression of diseases including cancer and autoimmunity, suggesting its potential as a good therapeutic target.

Activation of ACKR3 probed by radiolytic footprinting. Fig.1 Activation of ACKR3 probed by radiolytic footprinting. (Evans, 2017)

Application of ACKR3 Membrane Protein in Literature

  1. Hanes M.S., et al. Dual targeting of the chemokine receptors CXCR4 and ACKR3 with novel engineered chemokines. Journal of Biological Chemistry. 2015, 290(37): 22385-97. PubMed ID: 26216880

    This article finds that CXCR4 and ACKR3 have the potential to be broadly useful therapeutics because of their roles in many diseases, including cancer, inflammatory diseases, and AIDS.

  2. Freitas C., et al. The relevance of the chemokine receptor ACKR3/CXCR7 on CXCL12-mediated effects in cancers with a focus on virus-related cancers. Cytokine Growth Factor Rev. 2014, 25(3): 307-16. PubMed ID: 24853339

    This article suggests that ACKR3 plays a direct role in tumorigenesis, but more studies are needed to confirm that ACKR3 contributes to virus-related carcinogenesis in vivo.

  3. Williams J.L., et al. Targeting CXCR7/ACKR3 as a therapeutic strategy to promote remyelination in the adult central nervous system. Journal of Experimental Medicine. 2014, 211(5): 791-9. PubMed ID: 24733828

    This article suggests that a CXCR7 antagonist during demyelination is beneficial not only in the context of repair, but also during immune-mediated CNS injury, while leaving immune cell function largely intact.

  4. Szpakowska M., et al. Human herpesvirus 8-encoded chemokine vCCL2/vMIP-II is an agonist of the atypical chemokine receptor ACKR3/CXCR7. Biochemical Pharmacology. 2016, 114: 14-21. PubMed ID: 27238288

    This article reveals that ACKR3 regulates its availability and activity to human receptors, thus potentially controlling its role in hpv-8 infection.

  5. Wurth R., et al. A Preclinical Model of Inflammatory Breast Cancer to Study the Involvement of CXCR4 and ACKR3 in the Metastatic Process. Translational Oncology. 2015, 8(5): 358-67. PubMed ID: 26500026

    This article suggests IBC cells are an excellent tool for both in vitro and in vivo investigations concerning the roles of the CXCL12-CXCR4/ACKR3 axis in IBC migration, growth, and invasion.

ACKR3 Preparation Options

Membrane protein studies have advanced significantly over the past few years. Based on our versatile MemDX™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-ACKR3 antibody development services.


Creative Biolabs has successfully generated many functional membrane proteins with multiple active formats for our global customers. We are happy to accelerate the development of our clients’ programs with our one-stop, custom-oriented service. For more detailed information, please feel free to contact us.

Reference

  1. Evans A E, et al. (2017). Structural basis of ligand interaction with atypical chemokine receptor 3. Nature Communications. 8: 14135.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us