Close

CATSPERZ Membrane Protein Introduction

Introduction of CATSPERZ

Human CatSperζ is quadrilaterally arranged along the flagella, similar to the CatSper complex in mouse sperm. Targeted disruption of CatSperz reduces CatSper current and sperm rheotactic efficiency in mice, resulting in severe male subfertility. Normally distributed in linear quadrilateral nanodomains along the flagellum, the complex lacking CatSperζ is disrupted at ~0.8 μm intervals along the flagellum. This disruption renders the proximal flagellum inflexible and alters the 3D flagellar envelope, thus preventing sperm from reorienting against fluid flow in vitro and efficiently migrating in vivo.

Basic Information of CATSPERZ
Protein Name Cation channel sperm-associated protein subunit zeta
Gene Name CATSPERZ
Aliases CatSper-zeta, CatSperzeta, Testis-expressed protein 40
Organism Homo sapiens (Human)
UniProt ID Q9NTU4
Transmembrane Times 0
Length (aa) 200
Sequence MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN

Function of CATSPERZ Membrane Protein

Genetic disruption of mammalian-specific CatSperζ reduces the CatSper current in the sperm flagellum and hyperactivated motility, resulting in severe subfertility. Researchers use high speed video microscopy and digital image analysis to determine swimming trajectory and the flagellar waveform in detail. Surprisingly, abrogation of CatSperζ renders the proximal flagellum inflexible but preserves overall motility, thus resulting in restriction of the 3D flagellar envelope, inefficient sperm rheotaxis in vitro, and delayed sperm migration in vivo. Some reports also demonstrate that the structurally distinct CatSper Ca2+ signaling domains along the flagellum become fragmented in the absence of CatSperz.

CATSPERZ Membrane Protein IntroductionFig.1 Flagellar waveform traces. Movies recorded at 200 fps: CatSperz+/- (top) and CatSperz-/- (bottom) sperm cells attached on glass coverslips before capacitation (left), and 10 min (middle), and 90 min (right) after capacitation. Overlays of flagellar traces from two beat cycles are generated by hyperstacking binary images; time coded in color. (Chung, 2017)

Application of CATSPERZ Membrane Protein in Literature

  1. Chung J.J., et al. CatSperzeta regulates the structural continuity of sperm Ca2+ signaling domains and is required for normal fertility. Elife. 2017,6.

    This report speculates that the newly identified CatSperζ subunit is a late evolutionary adaptation to maximize fertilization inside the mammalian female reproductive tract.

CATSPERZ Preparation Options

We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced MemDX™ membrane protein production platform, we are able to present target membrane protein in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-CATSPERZ antibody development services.


Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful MemDX™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please feel free to contact us.

Reference

  1. Chung JJ, et al. (2017). CatSperζ regulates the structural continuity of sperm Ca2+ signaling domains and is required for normal fertility. eLife. 6.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us