Introduction of CD97 Antigen
CD97 antigen is a membrane protein that in human is encoded by the CD97 gene. It belongs to the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. CD97 is widely expressed on immune cells, hematopoietic stem and progenitor cells, muscle cells, epithelial cells as well as their malignant counterparts. This protein is cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which combine at the cell surface as a receptor complex.
| Basic Information of CD97 Antigen | |
| Protein Name | CD97 antigen |
| Gene Name | CD97 |
| Aliases | Leukocyte antigen CD97, CD_antigen: CD97 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P48960 |
| Transmembrane Times | 7 |
| Length (aa) | 835 |
| Sequence |
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETC DDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNP RLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQC RCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPN NQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIKLVDELMEAP GDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMG QSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHSKKQAELEEIYESSIRGVQ LRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKSD SDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDVEDWKLTLITRVGLALSLFCLLL CILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAF CWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQ GFLWSFLGPVTFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTW VFGLFIFDDRSLVLTYVFTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTST TSGTGHNQTRALRASESGI |
Function of CD97 Antigen Membrane Protein
CD97 antigen is the most broadly expressed GPCR (G-protein coupled receptor) member with roles in cell adhesion, migration and regulation of intercellular junctions. CD97 antigen contains multiple extracellular EGF-like repeats which mediate the bond with chondroitin sulfate B and decay accelerating factor (DAF/CD55). The ligands of CD97 also include α5β1 and αvβ3 integrins, as well as CD90 (Thy-1). CD97 antigen is also found in a variety of human malignancies including those of the stomach, thyroid, brain, and colon. It confers an invasive phenotype and has been shown to be associated with tumor grade, metastatic spread, lymph node invasion, and overall prognosis. CD97 antigen may play a role in both adhesion and signaling processes early after activation of leukocyte. It also may be involved in cell adhesion as well as leukocyte recruitment, activation, and migration (by similarity). Furthermore, CD97 is likely to play a role in auto-inflammatory diseases. And due to its role in tumor invasion and angiogenesis, CD97 is becoming an attractive therapeutic target.
Fig.1 Representation of the secondary structure of GPCRs. (Karnik, 2016)
Application of CD97 Antigen Membrane Protein in Literature
This article suggests that CD97 is necessary for tumor cell-induced vascular permeability in vivo and metastasis formation in preclinical models. The results support that the targeted blockade of tumor CD97 as an approach to ameliorate metastatic spread.
This article focuses on the role of CD97 in diabetes mellitus and indicates that the overexpression of CD97 improves high glucose-induced dysfunction of endothelial cell migration, which provides insight to assist in identifying therapeutic targets with potential to ameliorate certain vascular complications of diabetes.
This study indicates that biliary soluble CD97 can be regarded as a new biological marker of intrahepatic cholangiocarcinoma for early diagnosis, prediction of lymph node metastasis and poor prognosis, and discovery of a therapeutic target.
Authors in this group are aimed to elucidate the extracellular molecular basis of the CD97 EGF1-5 isoform in protein expression, auto-proteolysis, and cell adhesion, including epidermal growth factor (EGF)-like domain, GPCR autoproteolysis-inducing (GAIN) domain, as well as GPS mutagenesis and N-glycosylation.
This article shows the CD97 small isoform promotes SGC-L cell lymphatic metastasis exosome dependently and aided by the soluble fraction, the exosome-dependent CD97 plays a pivotal role in pre-metastatic niche formation.
CD97 Antigen Preparation Options
To prepare the soluble and functional target protein of your interest, our experienced scientists present robust reconstitution forms as well as multiple active formats for membrane proteins. Our legendary MemDX™ membrane protein production platform is flexible to offer different options, by which you can always find the most appropriate one for your project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-CD97 antibody development services.
The membrane protein team in Creative Biolabs was built by bringing together the market-leading membrane protein expertise around the world. With years of experience, our scientists offer high quality, reliable solutions to support our clients, and will spare no effort to advance their research and programs of membrane protein preparation. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.