Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GRPR
Gastrin-releasing peptide receptor (GRPR) is a seven-transmembrane-domain receptor of the GRPR superfamily. It is a mammalian homologue of the amphibian bombesin-like peptide receptor. GRPR is directly coupled to the Gq protein, and GRPR activation leads to an increase in cellular Ca2+ and stimulation of the PLC/PKC and ERK/MAPK pathways. In humans, it is highly expressed in the pancreas and is also expressed in other tissues such as the stomach, adrenal cortex, and brain. Moreover, it is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate.
| Basic Information of GRPR | |
| Protein Name | Gastrin-releasing peptide receptor |
| Gene Name | GRPR |
| Aliases | GRP-preferring bombesin receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | P30550 |
| Transmembrane Times | 7 |
| Length (aa) | 384 |
| Sequence |
MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNITLIKI FCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSV FTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQ TFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQ IESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNP FALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTSLKSTNPSVATFSLINGNICHERYV |
Functions of GRPR Membrane Protein
By binding to gastrin-releasing peptide (GRP), this receptor mediates different functions of the gastrointestinal and central nervous system, including the release of gastrointestinal hormones, smooth muscle contraction, and epithelial cell proliferation. Since they are distributed throughout the mammalian CNS, evidence has indicated that GRPR might be involved in the neurochemical alterations associated with psychiatric and neurological disorders, supporting that the GRPR should be considered as a therapeutic target for a subset of CNS diseases. Moreover, studies have reported that GRPR may be dedicated to mediating the itch sensation in the dorsal horn of the spinal cord, and thus may provide a central therapeutic target for antipruritic drug development. Additionally, studies have suggested that the GRPR may be potential therapeutic targets for many types of cancer. Moreover, this receptor contributes to the regulation of food intake and fear learning.
Applications of GRPR Membrane Protein in Literature
This study cloned and analyzed the pig gastrin-releasing peptide receptor (GRPR) cDNA, their expression levels and distribution in pig tissues, as well as the effect of GRP on porcine Leydig cells. The results showed that the CRP/GRPR system might be critical in regulating the reproductive system of the boar.
This article reported the development of a peptide-based non-viral gene delivery system: bombesin/oligoarginine and bombesin/oligoarginine/GALA fusion peptide. The efficiency of this delivery system was also evaluated.
This study evaluated the effect of N-terminal modulations of the statine-based GRPR antagonist on its binding affinity, pharmacokinetic properties, and in vivo metabolic stability.
This study explored the application of GRPR radioligands for imaging and therapy of breast cancer by using preclinical in vitro and in vivo models. The results showed that GRPR radioligands were promising tools for nuclear imaging and therapy.
This article reviewed the role of GRP/GRPR system in mediating the stress responses, memory, and fearful events. The results suggested GRPR as an important component in the neurobiological system, in both stress and memory.
GRPR Preparation Options
Membrane proteins are vital to life and are major therapeutic targets. As an undisputed leading service provider in the field of membrane proteins, Creative Biolabs is specialized in preparing membrane proteins in required functional formats using various strategies and methods. See Magic™ Membrane Protein Production Service for more information. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GRPR antibody development services.
With our unparalleled technologies and seasoned scientists, Creative Biolabs will provide you with high-quality membrane protein reconstitution products that are most suitable for your goals. Please feel free to contact us to start the conversation.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
