Introduction of NTR2
The neurotensin receptor family is composed of three subtypes, NTS1, NTS2, and NTS3. Neurotensin receptor type 2 (NTSR2) is a protein that in humans is encoded by the NTSR2 gene. This protein also belongs to the G protein-coupled receptor family. Its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and G-protein coupled neurotensin receptor activity. An important paralog of this gene is NTSR1.
| Basic Information of NTR2 | |
| Protein Name | Neurotensin receptor type 2 |
| Gene Name | NTSR2 |
| Aliases | NT-R-2, NTR2, Levocabastine-sensitive neurotensin receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | O95665 |
| Transmembrane Times | 7 |
| Length (aa) | 410 |
| Sequence | METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNAVSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT |
Function of NTSR2 Membrane Protein
NTSR2 activates a phosphatidylinositol-calcium second messenger system. Binding and pharmacological studies demonstrate that this receptor binds neurotensin as well as several other ligands already described for neurotensin NT1 receptor. And some study showed NTR1 and NTSR2 mRNA was not detected in either pituitary adenomas or normal tissue. However, unlike NT1 receptor, NTSR2 recognizes, with high affinity, levocabastine, a histamine H1 receptor antagonist previously shown to compete with neurotensin for low-affinity binding sites in the brain. These activities suggest that NTSR2 may be of physiological importance and that a natural agonist for the receptor may exist.
Fig.1 Structure of Neurotensin receptor.
Application of NTSR2 Membrane Protein in Literature
This article provided direct evidence for heterodimerization of human neurotensin type 1 receptor (hNTR1) and type 2 receptor (hNTSR2). Their study proposed a novel function of NTSR2 in the regulation of NTR1 activity.
This article showed two specific neurotensin receptors, NTSR1 and NTSR2, were shown to be expressed by human B cell lines. And a quantitative study of gene expression in two malignant B cell diseases showed that NTSR2 was overexpressed, NTSR1 decreased, and neurotensin was unexpressed in B cell leukemia patient's cells, as compared with healthy B cells.
This article supported the use of NTRs as tools for therapeutic targeting in prostate cancers composed of both poorly differentiated and/or well-differentiated cells.
In this article, they investigated the expression profiles and cellular functions of the NTSRs, they showed that expression levels for NTS and NTSR1 varied, that NTSR2 expression was not detectable and that NTSR3 was consistently expressed in all CRC cell lines examined. And their findings identified promoter methylation as an important process regulating the differential expression or silencing of NTSR1/2 in CRC cells.
This article evaluated the expression of NT and its receptors NTR1, 2 and 3, they found NTR3 mRNA expression was observed. By contrast, NTR1 and NTSR2 mRNA were not detected in either pituitary adenomas or normal tissue.
NTSR2 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-NTSR2 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.