Close

QRFPR Membrane Protein Introduction

Introduction of QRFPR

Pyroglutamylated RFamide peptide receptor (QRFPR), also known as orexigenic neuropeptide QRFP receptor or G-protein coupled receptor 103 (GPR103), is a protein that in humans is encoded by the QRFPR gene. Orphan G-protein-coupled receptors are a large class of receptors whose cognate ligands are unknown. QRFPR is an orphan G-protein-coupled receptor originally cloned from a human brain cDNA library. It has found to be predominantly expressed in brain, heart, kidney, retina, and testis.

Basic Information of QRFPR
Protein Name Pyroglutamylated RF amide peptide receptor
Gene Name QRFPR
Aliases Pyroglutamylated RFamide peptide receptor, AQ27, G-protein coupled receptor 103, Orexigenic neuropeptide QRFP receptor, SP9155
Organism Homo sapiens (Human)
UniProt ID Q96P65
Transmembrane Times 7
Length (aa) 431
Sequence MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALALFGNA
LVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKMVPFVQSTA
VVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDF
LYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTI
HGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQII
GFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVE
ETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENSPLDSGH

Function of QRFPR Membrane Protein

QRFPR plays a vital role in many biological functions. Some research suggests that QRFPR works in an autocrine/paracrine manner to regulate adipogenesis. And the intravenous administration of QRFP caused the release of aldosterone, suggesting that QRFP and its receptor have a regulatory function in the rat adrenal gland. In addition, a 26-amino acid RF-amide peptide, P518 functions as a high-affinity ligand of QRFPR. Both GPR103 and P518 precursor mRNA exhibited highest expression in brain. The 43-amino acid QRFP peptide, a longer form of the P518 peptide is necessary to exhibit full agonistic activity with QRFPR. Intravenous administration QRFP caused release of aldosterone, suggesting that QRFP and QRFPR regulate adrenal function.

QRFPR Membrane Protein Introduction

Application of QRFPR Membrane Protein in Literature

  1. Fukusumi S., et al. A new peptidic ligand and its receptor regulating adrenal function in rats. J. Biol. Chem. 2003, 278(47): 46387-46395. PubMed ID:12960173

    The article indicates that the intravenous administration of QRFP caused the release of aldosterone, suggesting that QRFP and its receptor have a regulatory function in the rat adrenal gland.

  2. Jiang Y., et al. Identification and characterization of a novel RF-amide peptide ligand for orphan G-protein-coupled receptor SP9155. J. Biol. Chem. 2003. PubMed ID:12714592

    The article suggests that the existence of a novel RF-amide neuroendocrine peptide system, and suggest that QRFPR is likely the relevant G-protein-coupled receptor for this peptide.

  3. Rouméas L., et al. Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103. Peptides. 2015, 71: 156-161. PubMed ID: 26211894

    The article results highlight the difficulty to develop selective peptide ligands for GPR10, GPR54 or QRFPR without a modification of the C-terminus RF-amide signature but open the door to the design of new RF-amide peptides acting as agonists for one receptor and antagonist for another one.

  4. Takayasu S., et al. A neuropeptide ligand of the G protein-coupled receptor GPR103 regulates feeding, behavioral arousal, and blood pressure in mice. Proc Natl Acad Sci U S A. 2006, 103(19): 7438-7443. PubMed ID:16648250

    The article suggests that QRFP and QRFPR A/B may regulate diverse neuroendocrine and behavioral functions and implicate this neuropeptide system in metabolic syndrome.

  5. Kimura K., et al. Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. Genome Res. 2006, 16(1): 55-65. PubMed ID:16344560

    The article suggests that use of alternate promoters and consequent alternative use of first exons should play a pivotal role in generating the complexity required for the highly elaborated molecular systems in humans.

QRFPR Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-QRFPR antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us