Introduction of QRFPR
Pyroglutamylated RFamide peptide receptor (QRFPR), also known as orexigenic neuropeptide QRFP receptor or G-protein coupled receptor 103 (GPR103), is a protein that in humans is encoded by the QRFPR gene. Orphan G-protein-coupled receptors are a large class of receptors whose cognate ligands are unknown. QRFPR is an orphan G-protein-coupled receptor originally cloned from a human brain cDNA library. It has found to be predominantly expressed in brain, heart, kidney, retina, and testis.
| Basic Information of QRFPR | |
| Protein Name | Pyroglutamylated RF amide peptide receptor |
| Gene Name | QRFPR |
| Aliases | Pyroglutamylated RFamide peptide receptor, AQ27, G-protein coupled receptor 103, Orexigenic neuropeptide QRFP receptor, SP9155 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q96P65 |
| Transmembrane Times | 7 |
| Length (aa) | 431 |
| Sequence |
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALALFGNA LVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKMVPFVQSTA VVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDF LYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTI HGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQII GFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVE ETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENSPLDSGH |
Function of QRFPR Membrane Protein
QRFPR plays a vital role in many biological functions. Some research suggests that QRFPR works in an autocrine/paracrine manner to regulate adipogenesis. And the intravenous administration of QRFP caused the release of aldosterone, suggesting that QRFP and its receptor have a regulatory function in the rat adrenal gland. In addition, a 26-amino acid RF-amide peptide, P518 functions as a high-affinity ligand of QRFPR. Both GPR103 and P518 precursor mRNA exhibited highest expression in brain. The 43-amino acid QRFP peptide, a longer form of the P518 peptide is necessary to exhibit full agonistic activity with QRFPR. Intravenous administration QRFP caused release of aldosterone, suggesting that QRFP and QRFPR regulate adrenal function.
Application of QRFPR Membrane Protein in Literature
The article indicates that the intravenous administration of QRFP caused the release of aldosterone, suggesting that QRFP and its receptor have a regulatory function in the rat adrenal gland.
The article suggests that the existence of a novel RF-amide neuroendocrine peptide system, and suggest that QRFPR is likely the relevant G-protein-coupled receptor for this peptide.
The article results highlight the difficulty to develop selective peptide ligands for GPR10, GPR54 or QRFPR without a modification of the C-terminus RF-amide signature but open the door to the design of new RF-amide peptides acting as agonists for one receptor and antagonist for another one.
The article suggests that QRFP and QRFPR A/B may regulate diverse neuroendocrine and behavioral functions and implicate this neuropeptide system in metabolic syndrome.
The article suggests that use of alternate promoters and consequent alternative use of first exons should play a pivotal role in generating the complexity required for the highly elaborated molecular systems in humans.
QRFPR Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-QRFPR antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.