RXFP2 Membrane Protein Introduction

Introduction of RXFP2

RXFP2 is closely related to the relaxin receptor, LGR7, and has been recently classified as relaxin family peptide (RXFP) receptor. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. It belongs to the class C G-protein-coupled receptor-rich in leucine repeats. Its structural features are that the extracellular region contains leucine repeat repeats (LRRs), and the N-terminal contains a low-density lipoprotein receptor type A module. It plays an important role in signal transduction.

Basic Information of RXFP2
Protein Name	Relaxin Receptor 2
Gene Name	RXFP2
Aliases	GPR106, GREAT, LGR8
Organism	Homo sapiens (Human)
UniProt ID	Q8WXD0
Transmembrane Times	7
Length (aa)	754
Sequence	MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDD CGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNV TLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKAFFGLCNLQILYLNHNCITTLRPGIFKD LHQLTWLILDDNPITRISQRLFTGLNSLFFLSMVNNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNS TFLSCDSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNTITELSPHLFKDLKLLQKLNLSSNPLMY LHKNQFESLKQLQSLDLERIEIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSFED LLANNILRIFVWVIAFITCFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGIFDIKYR GQYQKYALLWMESVQCRLMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWM AGFLIAVIPFWNKDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFLIIVFSYITMFCS IQKTALQTTEVRNCFGREVAVANRFFFIVFSDAICWIPVFVVKILSLFRVEIPDTMTSWIVIFFLPVN SALNPILYTLTTNFFKDKLKQLLHKHQRKSIFKIKKKSLSTSIVWIEDSSSLKLGVL NKITLGDSIMKPVS

Function of RXFP2

RXFP2 can bind to relaxin-2, relaxin-3 and INSL-3, of which INSL-3 has the highest affinity to RXFP2. The phenotypes of RXFP2 knockout mice and INSL-3 knockout mice both show cryptorchidism. INSL-3 binds to RXFP2 distributed in the gubernaculum and regulates the embryonic period testicles drop. However, INSL-3 is not sufficient to mediate normal testicular decline. Testicular decline also requires androgen to regulate suspensory ligament. In addition to its involvement in regulating testicular decline, the INSL-3-RXFP2 system is also involved in regulating follicular atresia and corpus luteum apoptosis in female animals. INSL-3 knockout female mice exhibited accelerated follicular atresia and premature apoptosis of the corpus luteum.

Fig.1 Structure of RXFP2 membrane protein.

Application of RXFP2 in Literature

Koskimies P., et al. A common polymorphism in the human relaxin-like factor (RLF) gene: no relationship with cryptorchidism. Pediatr Res. 2000, 47(4 Pt 1): 538-41. PubMed ID: 10759163

This article reports that RXFP2 plays a role in testicular descent in fetal life, which suggests an important function of the RXFP2 in cryptorchidism.
Overbeek P.A., et al. A transgenic insertion causing cryptorchidism in mice. Genesis. 2001, 30(1): 26-35. PubMed ID: 11353515

This article reveals that a candidate gene encoding a novel G protein-coupled receptor (Great) with an expression pattern suggesting involvement in testicular descent has been identified.
Spanel-Borowski K., et al. Increase in final stages of follicular atresia and premature decay of corpora lutea in Insl3 –deficient mice. Mol Reprod Dev. 2001, 58(3): 281-6. PubMed ID: 11170269

This article reveals the regulating role of the Insl3 factor on the gubernaculum development during the transabdominal descent of the testis.
Hsu S.Y., et al. Activation of orphan receptors by the hormone relaxin. Science. 2002, 295(5555): 671-4. PubMed ID: 11809971

Author’s group demonstrate that two orphan heterotrimeric guanine nucleotide binding protein (G protein)-coupled receptors, LGR7 and LGR8, are capable of mediating the action of relaxin through an adenosine 3',5'-monophosphate (cAMP)-dependent pathway distinct from that of the structurally related insulin and insulin-like growth factor family ligand.

RXFP2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-RXFP2 antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: