Zinc transporter ZIP5 (short for ZIP-5), alternatively known as the Zrt- and Irt-like protein 5 or SLC39A5, is encoded by the SLC39A5 gene in human. The zinc transporter SLC39A5 is a member of the ZIP family of metal ion transporters, which is also known as solute carrier family 39 (SLC39). SLC39A5 expression is restricted to many tissues that are important for zinc homeostasis, including liver, kidney, pancreas, small intestine, colon, spleen, fetal liver, and fetal kidney. The sequence of SLC39A5 protein is similar to the SLC39A4 protein.
| Basic Information of SLC39A5 | |
| Protein Name | Zinc transporter ZIP5 |
| Gene Name | SLC39A5 |
| Aliases | Solute carrier family 39 member 5, Zrt- and Irt-like protein 5, ZIP-5 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q6ZMH5 |
| Transmembrane Times | 6 |
| Length (aa) | 540 |
| Sequence | MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG |
Zrt- and Irt-like protein (ZIP) family has been thought to control the cytosolic concentration of zinc by transporting zinc into the cytoplasm from the extracellular space or from intracellular compartments. SLC39A5 is found in the basolateral membranes of pancreatic acinar cells and intestinal enterocytes, which are supposed to control zinc excretion from the body, and SLC39A5 proteins are internalized and degraded coordinately in these cell-types during periods of dietary zinc deficiency. The zinc-regulation and basolateral localization of SLC39A5 in these cells are unique among the 14 members of the SLC39 family. The SLC39A5 protein may have an effect on polarized cells by carrying out serosal-to-mucosal zinc transport. It also plays a role in eye development. It can regulate extracellular matrix (ECM) proteins of the sclera and modulate the BMP/TGF-beta (bone morphogenetic protein/transforming growth factor-beta) signaling pathway. Co-expression of SLC39A4 and SLC39A5 in the intestine led to the hypothesis that these proteins play overlapping roles in the uptake of dietary zinc across the apical membrane of intestinal enterocytes.
Fig.1 Subcellular localization and the direction of zinc transport of ZnT and ZIP transporters. (Kambe, 2015)
Authors of this study attempt to reassure the presence of characteristic enterocyte-specific properties in the Caco-2-eCalwy clone and indicate that introduction of the additional zinc-binding protein in Caco-2 cells did not alter mRNA expression of the major intestinal zinc transporters, including ZIP5.
Authors of this study demonstrate that knockdown of Zip71B/dZip5 or ZnT35C is able to mitigate stone formation, consistent with their roles in tubular zinc homeostasis.
This article indicates that knocking down ZIP5 by small interfering RNA (siRNA) may be a new treatment strategy for esophageal cancer.
This study aims to investigate the role of ZIP5 in esophageal cancer cells, and the results show that ZIP5 knockdown could inhibit cell progression in ESCC.
Results of this study reveal that ZIP5 is involved in the control of zinc excretion in mice and functions in acinar cells to protect against zinc-induced acute pancreatitis.
Our exquisite MemDX™ membrane protein production platform allows robust reconstitution forms as well as multiple active formats for membrane proteins. To prepare the soluble and functional target protein of your interest, we are committed to offering customized services with fast turnaround times. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC39A5 antibody development services.
Creative Biolabs who always focus on the hotspot of scientific research, offers the most comprehensive portfolio of membrane protein preparation related services. Our scientists aim to accelerate access to a comprehensive solution for membrane protein studies for our worldwide clients. Please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.