Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of SSTR5
SSTR5 (Somatostatin Receptor 5) is a protein that in human is encoded by the SSTR5 gene, which lacks introns within its coding sequence, and hence, the splicing variants identified are generated by non-canonical splicing events. SSTR5 and its truncated splicing variants (sst5TMD5, sst5TMD4) are suggested putative biomarkers that are enable to predict pharmacological response or aggressiveness in a variety of endocrine-related pathologies, such as acromegaly. SSTR5 belongs to the G-protein coupled receptor superfamily (GPCR) and is a member of the somatostatin receptor protein family.
| Basic Information of SSTR5 | |
| Protein Name | Somatostatin receptor type 5 |
| Gene Name | SSTR5 |
| Aliases | SS-5-R, SS5-R |
| Organism | Homo sapiens (Human) |
| UniProt ID | P35346 |
| Transmembrane Times | 7 |
| Length (aa) | 364 |
| Sequence |
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAK MKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLA VVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGF FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEP ASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPA HRAAANGLMQTSKL |
Function of SSTR5 Membrane Protein
Somatostatin, also known as SRIF (somatotropin release inhibiting factor), is an endogenous cyclic 14 amino acid polypeptide (SRIF-14, a tetradecapeptide). And somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of many hormones and other secretory proteins. It consists of 5 subtypes, in which SST5 is the receptor for somatostatin 28 and to a lesser extent for somatostatin-14. Besides, SSTR5 is associated with diseases, including Pituitary Adenoma, Pituitary Adenoma, as well as Prolactin-Secreting. In addition, SSTR3 is an important paralog of SSTR5.
Fig.1 Structure of SSTR5 membrane protein.
Application of SSTR5 Membrane Protein in Literature
The aim of this article was to determine the expression of the SSTR subtypes via immunohistochemistry analyses and assess the correlation between SSTR subtype expression and prognosis. And data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
In this paper, they explore the correlation between the SSTR subtype messenger RNA (mRNA) expression and clinicopathological features of PET. And the data also shows that the mRNA levels of SSTR1, SSTR2, SSTR3, and SSTR5 were high in PET compared with AC, whereas the expression of SSTR4 was low in PET and AC.
This article analyzed 39 somatotrophinomas patients treated with somatostain analogs, and found the most expressed SSTR was SSTR5, SSTR3, SSTR2, SSTR1, and SSTR4, respectively.
This article shows IHC of SSTR subtypes in the different cohorts and SSTR2 staining intensity scores higher than SSTR5 in TSHoma, acromegaly and prolactinoma, whereas the expression of SSTR5 was stronger than SSTR2 in corticotropinoma and NFPA. And short-term response to OCT therapy may be related to the expression of SSTR5.
SSTR5 was the predominantly expressed receptor subtype in the cytoplasm of all GH-secreting adenomas tested, regardless of whether they came from octreotide-naive, octreotide-responsive, or octreotide-resistant patients. SSTR5 mRNA predominance was significant only in octreotide treated patients. Its expression was not correlated with baseline or post-octreotide GH or IGF-1 levels or tumor volume.
SSTR5 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SSTR5 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
